BLASTX nr result
ID: Akebia26_contig00012081
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00012081 (381 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU43065.1| hypothetical protein MIMGU_mgv1a005789mg [Mimulus... 71 1e-10 ref|XP_002318119.2| aspartyl aminopeptidase family protein [Popu... 71 2e-10 ref|XP_006826610.1| hypothetical protein AMTR_s00138p00074300 [A... 70 3e-10 ref|XP_006476998.1| PREDICTED: probable aspartyl aminopeptidase-... 69 5e-10 ref|XP_006351481.1| PREDICTED: probable aspartyl aminopeptidase-... 69 5e-10 ref|XP_006440072.1| hypothetical protein CICLE_v10019750mg [Citr... 69 5e-10 ref|XP_007037930.1| Zn-dependent exopeptidases superfamily prote... 69 5e-10 ref|XP_004236341.1| PREDICTED: probable aspartyl aminopeptidase-... 68 1e-09 ref|NP_200824.1| zn-dependent exopeptidases superfamily protein ... 68 2e-09 gb|AAM61631.1| aspartyl aminopeptidase-like protein [Arabidopsis... 68 2e-09 sp|B9RAJ0.2|DNPEP_RICCO RecName: Full=Probable aspartyl aminopep... 67 2e-09 ref|XP_002511215.1| Aspartyl aminopeptidase, putative [Ricinus c... 67 2e-09 ref|XP_002866374.1| hypothetical protein ARALYDRAFT_332278 [Arab... 67 3e-09 ref|XP_006280394.1| hypothetical protein CARUB_v10026321mg [Caps... 67 3e-09 ref|NP_001066463.1| Os12g0236500 [Oryza sativa Japonica Group] g... 66 6e-09 gb|ABR25597.1| aspartyl aminopeptidase [Oryza sativa Indica Group] 66 6e-09 ref|XP_006402123.1| hypothetical protein EUTSA_v10015798mg [Eutr... 65 8e-09 ref|XP_003602076.1| Aspartyl aminopeptidase [Medicago truncatula... 65 8e-09 ref|XP_004500663.1| PREDICTED: probable aspartyl aminopeptidase-... 65 1e-08 ref|XP_002321687.1| aspartyl aminopeptidase family protein [Popu... 65 1e-08 >gb|EYU43065.1| hypothetical protein MIMGU_mgv1a005789mg [Mimulus guttatus] Length = 470 Score = 71.2 bits (173), Expect = 1e-10 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +3 Query: 3 SIREMCGVDDVKHSYEHFKAFFEEFSQLDAKITVDI 110 SIREMC VDDVKHSYEHFKAFF+EFS LDAK+TVDI Sbjct: 435 SIREMCAVDDVKHSYEHFKAFFQEFSNLDAKLTVDI 470 >ref|XP_002318119.2| aspartyl aminopeptidase family protein [Populus trichocarpa] gi|550326763|gb|EEE96339.2| aspartyl aminopeptidase family protein [Populus trichocarpa] Length = 486 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +3 Query: 3 SIREMCGVDDVKHSYEHFKAFFEEFSQLDAKITVDI 110 SIREMC VDDVKHSYEHFKAFF+EFS LDAKITVD+ Sbjct: 451 SIREMCAVDDVKHSYEHFKAFFQEFSDLDAKITVDM 486 >ref|XP_006826610.1| hypothetical protein AMTR_s00138p00074300 [Amborella trichopoda] gi|548830991|gb|ERM93847.1| hypothetical protein AMTR_s00138p00074300 [Amborella trichopoda] Length = 344 Score = 70.1 bits (170), Expect = 3e-10 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +3 Query: 3 SIREMCGVDDVKHSYEHFKAFFEEFSQLDAKITVDI 110 SIREMC VDDVKHSYEHFKAFF EF+QLDAKI+VD+ Sbjct: 309 SIREMCSVDDVKHSYEHFKAFFHEFAQLDAKISVDV 344 >ref|XP_006476998.1| PREDICTED: probable aspartyl aminopeptidase-like [Citrus sinensis] Length = 483 Score = 69.3 bits (168), Expect = 5e-10 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +3 Query: 3 SIREMCGVDDVKHSYEHFKAFFEEFSQLDAKITVDI 110 SIREMC VDDVKHSYEHFKAFF+EFS+LDAKI VD+ Sbjct: 448 SIREMCAVDDVKHSYEHFKAFFQEFSELDAKIKVDM 483 >ref|XP_006351481.1| PREDICTED: probable aspartyl aminopeptidase-like [Solanum tuberosum] Length = 483 Score = 69.3 bits (168), Expect = 5e-10 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = +3 Query: 3 SIREMCGVDDVKHSYEHFKAFFEEFSQLDAKITVDI 110 SIREMC VDDVKHSYEHFKAFF++FSQLD KI VDI Sbjct: 448 SIREMCAVDDVKHSYEHFKAFFQDFSQLDGKIAVDI 483 >ref|XP_006440072.1| hypothetical protein CICLE_v10019750mg [Citrus clementina] gi|557542334|gb|ESR53312.1| hypothetical protein CICLE_v10019750mg [Citrus clementina] Length = 515 Score = 69.3 bits (168), Expect = 5e-10 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +3 Query: 3 SIREMCGVDDVKHSYEHFKAFFEEFSQLDAKITVDI 110 SIREMC VDDVKHSYEHFKAFF+EFS+LDAKI VD+ Sbjct: 480 SIREMCAVDDVKHSYEHFKAFFQEFSELDAKIKVDM 515 >ref|XP_007037930.1| Zn-dependent exopeptidases superfamily protein [Theobroma cacao] gi|508775175|gb|EOY22431.1| Zn-dependent exopeptidases superfamily protein [Theobroma cacao] Length = 520 Score = 69.3 bits (168), Expect = 5e-10 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = +3 Query: 3 SIREMCGVDDVKHSYEHFKAFFEEFSQLDAKITVDI 110 SIREMC VDDVKHSYEHFKAFF+EFS LD KITVD+ Sbjct: 485 SIREMCAVDDVKHSYEHFKAFFQEFSHLDTKITVDM 520 >ref|XP_004236341.1| PREDICTED: probable aspartyl aminopeptidase-like [Solanum lycopersicum] Length = 482 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +3 Query: 3 SIREMCGVDDVKHSYEHFKAFFEEFSQLDAKITVDI 110 SIREMC VDDVKHSY+HFKAFF++FSQLD KI VDI Sbjct: 447 SIREMCAVDDVKHSYDHFKAFFQDFSQLDGKIAVDI 482 >ref|NP_200824.1| zn-dependent exopeptidases superfamily protein [Arabidopsis thaliana] gi|8885567|dbj|BAA97497.1| aspartyl aminopeptidase [Arabidopsis thaliana] gi|15010566|gb|AAK73942.1| AT5g60160/f15l12_20 [Arabidopsis thaliana] gi|22137040|gb|AAM91365.1| At5g60160/f15l12_20 [Arabidopsis thaliana] gi|332009904|gb|AED97287.1| zn-dependent exopeptidases superfamily protein [Arabidopsis thaliana] Length = 477 Score = 67.8 bits (164), Expect = 2e-09 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = +3 Query: 3 SIREMCGVDDVKHSYEHFKAFFEEFSQLDAKITVDI 110 SIREMC DDVKHSYEHFKAFF+EF+ LDAK+T+D+ Sbjct: 442 SIREMCAADDVKHSYEHFKAFFQEFTHLDAKLTIDV 477 >gb|AAM61631.1| aspartyl aminopeptidase-like protein [Arabidopsis thaliana] Length = 477 Score = 67.8 bits (164), Expect = 2e-09 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = +3 Query: 3 SIREMCGVDDVKHSYEHFKAFFEEFSQLDAKITVDI 110 SIREMC DDVKHSYEHFKAFF+EF+ LDAK+T+D+ Sbjct: 442 SIREMCAADDVKHSYEHFKAFFQEFTHLDAKLTIDV 477 >sp|B9RAJ0.2|DNPEP_RICCO RecName: Full=Probable aspartyl aminopeptidase Length = 491 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = +3 Query: 3 SIREMCGVDDVKHSYEHFKAFFEEFSQLDAKITVDI 110 SIREMC VDDVK+SYEHFKAFFE+FS LD+KITVD+ Sbjct: 456 SIREMCAVDDVKYSYEHFKAFFEDFSHLDSKITVDM 491 >ref|XP_002511215.1| Aspartyl aminopeptidase, putative [Ricinus communis] gi|223550330|gb|EEF51817.1| Aspartyl aminopeptidase, putative [Ricinus communis] Length = 441 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = +3 Query: 3 SIREMCGVDDVKHSYEHFKAFFEEFSQLDAKITVDI 110 SIREMC VDDVK+SYEHFKAFFE+FS LD+KITVD+ Sbjct: 406 SIREMCAVDDVKYSYEHFKAFFEDFSHLDSKITVDM 441 >ref|XP_002866374.1| hypothetical protein ARALYDRAFT_332278 [Arabidopsis lyrata subsp. lyrata] gi|297312209|gb|EFH42633.1| hypothetical protein ARALYDRAFT_332278 [Arabidopsis lyrata subsp. lyrata] Length = 477 Score = 67.0 bits (162), Expect = 3e-09 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = +3 Query: 3 SIREMCGVDDVKHSYEHFKAFFEEFSQLDAKITVDI 110 SIREMC DDVKHSY+HFKAFF+EF+ LDAK+TVD+ Sbjct: 442 SIREMCAADDVKHSYDHFKAFFQEFTHLDAKLTVDV 477 >ref|XP_006280394.1| hypothetical protein CARUB_v10026321mg [Capsella rubella] gi|482549098|gb|EOA13292.1| hypothetical protein CARUB_v10026321mg [Capsella rubella] Length = 478 Score = 66.6 bits (161), Expect = 3e-09 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = +3 Query: 3 SIREMCGVDDVKHSYEHFKAFFEEFSQLDAKITVDI 110 SIREMC DDV+HSYEHFKAFF+EF+ LDAK+TVD+ Sbjct: 443 SIREMCAADDVEHSYEHFKAFFQEFTHLDAKLTVDV 478 >ref|NP_001066463.1| Os12g0236500 [Oryza sativa Japonica Group] gi|77554110|gb|ABA96906.1| Aspartyl aminopeptidase, putative, expressed [Oryza sativa Japonica Group] gi|113648970|dbj|BAF29482.1| Os12g0236500 [Oryza sativa Japonica Group] gi|125536203|gb|EAY82691.1| hypothetical protein OsI_37907 [Oryza sativa Indica Group] gi|125578926|gb|EAZ20072.1| hypothetical protein OsJ_35672 [Oryza sativa Japonica Group] Length = 478 Score = 65.9 bits (159), Expect = 6e-09 Identities = 27/35 (77%), Positives = 33/35 (94%) Frame = +3 Query: 3 SIREMCGVDDVKHSYEHFKAFFEEFSQLDAKITVD 107 SIREMC VDD+KHSYEHFKA+FEEF++LD+K+ VD Sbjct: 443 SIREMCAVDDIKHSYEHFKAYFEEFTELDSKVKVD 477 >gb|ABR25597.1| aspartyl aminopeptidase [Oryza sativa Indica Group] Length = 149 Score = 65.9 bits (159), Expect = 6e-09 Identities = 27/35 (77%), Positives = 33/35 (94%) Frame = +3 Query: 3 SIREMCGVDDVKHSYEHFKAFFEEFSQLDAKITVD 107 SIREMC VDD+KHSYEHFKA+FEEF++LD+K+ VD Sbjct: 114 SIREMCAVDDIKHSYEHFKAYFEEFTELDSKVKVD 148 >ref|XP_006402123.1| hypothetical protein EUTSA_v10015798mg [Eutrema salsugineum] gi|557103213|gb|ESQ43576.1| hypothetical protein EUTSA_v10015798mg [Eutrema salsugineum] Length = 465 Score = 65.5 bits (158), Expect = 8e-09 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = +3 Query: 3 SIREMCGVDDVKHSYEHFKAFFEEFSQLDAKITVDI 110 SIREMC DDVKHSYEHFKAFF EF+ LDAK+ VD+ Sbjct: 430 SIREMCAADDVKHSYEHFKAFFREFTHLDAKLAVDV 465 >ref|XP_003602076.1| Aspartyl aminopeptidase [Medicago truncatula] gi|355491124|gb|AES72327.1| Aspartyl aminopeptidase [Medicago truncatula] Length = 482 Score = 65.5 bits (158), Expect = 8e-09 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +3 Query: 3 SIREMCGVDDVKHSYEHFKAFFEEFSQLDAKITVDI 110 SIREMC VDDVK+SYEHFKAFF+EFS LDA I VDI Sbjct: 447 SIREMCAVDDVKYSYEHFKAFFKEFSHLDANIVVDI 482 >ref|XP_004500663.1| PREDICTED: probable aspartyl aminopeptidase-like [Cicer arietinum] Length = 482 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = +3 Query: 3 SIREMCGVDDVKHSYEHFKAFFEEFSQLDAKITVDI 110 SIREMC VDDVK+SYEHFKAFF+EFS LDA + VDI Sbjct: 447 SIREMCAVDDVKYSYEHFKAFFQEFSHLDANLVVDI 482 >ref|XP_002321687.1| aspartyl aminopeptidase family protein [Populus trichocarpa] gi|222868683|gb|EEF05814.1| aspartyl aminopeptidase family protein [Populus trichocarpa] Length = 489 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = +3 Query: 3 SIREMCGVDDVKHSYEHFKAFFEEFSQLDAKITVDI 110 SIREMC VDDVK+SYEHFKAFF++ S LDAKITVD+ Sbjct: 454 SIREMCSVDDVKYSYEHFKAFFQDISHLDAKITVDM 489