BLASTX nr result
ID: Akebia26_contig00011983
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00011983 (461 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007011750.1| Type-b response regulator, putative [Theobro... 65 1e-08 ref|XP_006483454.1| PREDICTED: two-component response regulator ... 64 2e-08 ref|XP_006483453.1| PREDICTED: two-component response regulator ... 64 2e-08 ref|XP_006450309.1| hypothetical protein CICLE_v10007639mg [Citr... 64 2e-08 ref|XP_006450308.1| hypothetical protein CICLE_v10007639mg [Citr... 64 2e-08 ref|XP_007226815.1| hypothetical protein PRUPE_ppa024819mg, part... 63 4e-08 ref|XP_003570300.1| PREDICTED: two-component response regulator ... 63 4e-08 gb|EXB38648.1| Two-component response regulator [Morus notabilis] 63 5e-08 ref|XP_004954220.1| PREDICTED: two-component response regulator ... 62 6e-08 ref|XP_006587150.1| PREDICTED: two-component response regulator ... 62 8e-08 ref|XP_003533888.2| PREDICTED: two-component response regulator ... 62 8e-08 ref|XP_002308698.2| hypothetical protein POPTR_0006s27800g [Popu... 62 8e-08 ref|XP_004157093.1| PREDICTED: LOW QUALITY PROTEIN: two-componen... 62 8e-08 ref|XP_004145510.1| PREDICTED: two-component response regulator ... 62 8e-08 ref|XP_003546612.1| PREDICTED: two-component response regulator ... 62 8e-08 gb|ACU18532.1| unknown [Glycine max] 62 8e-08 ref|XP_007136967.1| hypothetical protein PHAVU_009G0889000g, par... 62 1e-07 ref|XP_003526216.1| PREDICTED: two-component response regulator ... 62 1e-07 ref|XP_006473989.1| PREDICTED: two-component response regulator ... 61 1e-07 ref|XP_006453634.1| hypothetical protein CICLE_v10007648mg [Citr... 61 1e-07 >ref|XP_007011750.1| Type-b response regulator, putative [Theobroma cacao] gi|508782113|gb|EOY29369.1| Type-b response regulator, putative [Theobroma cacao] Length = 625 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +1 Query: 364 SGNGDTKLVMKGITHGACDYLLKPVRIEELWN 459 S NGDTKLVMKGITHGACDYLLKPVRIEEL N Sbjct: 97 SANGDTKLVMKGITHGACDYLLKPVRIEELQN 128 >ref|XP_006483454.1| PREDICTED: two-component response regulator ARR12-like isoform X2 [Citrus sinensis] Length = 654 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +1 Query: 364 SGNGDTKLVMKGITHGACDYLLKPVRIEELWN 459 SGNGD KLVMKGITHGACDYLLKPVRIEEL N Sbjct: 94 SGNGDPKLVMKGITHGACDYLLKPVRIEELKN 125 >ref|XP_006483453.1| PREDICTED: two-component response regulator ARR12-like isoform X1 [Citrus sinensis] Length = 663 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +1 Query: 364 SGNGDTKLVMKGITHGACDYLLKPVRIEELWN 459 SGNGD KLVMKGITHGACDYLLKPVRIEEL N Sbjct: 94 SGNGDPKLVMKGITHGACDYLLKPVRIEELKN 125 >ref|XP_006450309.1| hypothetical protein CICLE_v10007639mg [Citrus clementina] gi|557553535|gb|ESR63549.1| hypothetical protein CICLE_v10007639mg [Citrus clementina] Length = 663 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +1 Query: 364 SGNGDTKLVMKGITHGACDYLLKPVRIEELWN 459 SGNGD KLVMKGITHGACDYLLKPVRIEEL N Sbjct: 94 SGNGDPKLVMKGITHGACDYLLKPVRIEELKN 125 >ref|XP_006450308.1| hypothetical protein CICLE_v10007639mg [Citrus clementina] gi|557553534|gb|ESR63548.1| hypothetical protein CICLE_v10007639mg [Citrus clementina] Length = 695 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +1 Query: 364 SGNGDTKLVMKGITHGACDYLLKPVRIEELWN 459 SGNGD KLVMKGITHGACDYLLKPVRIEEL N Sbjct: 94 SGNGDPKLVMKGITHGACDYLLKPVRIEELKN 125 >ref|XP_007226815.1| hypothetical protein PRUPE_ppa024819mg, partial [Prunus persica] gi|462423751|gb|EMJ28014.1| hypothetical protein PRUPE_ppa024819mg, partial [Prunus persica] Length = 659 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 364 SGNGDTKLVMKGITHGACDYLLKPVRIEELWN 459 S NGDTKLVMKGITHGACDYLLKPVRIE+L N Sbjct: 97 SANGDTKLVMKGITHGACDYLLKPVRIEQLKN 128 >ref|XP_003570300.1| PREDICTED: two-component response regulator ARR12-like [Brachypodium distachyon] Length = 671 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 364 SGNGDTKLVMKGITHGACDYLLKPVRIEELWN 459 SGNG+TK VMKGITHGACDYLLKPVRIEEL N Sbjct: 100 SGNGETKTVMKGITHGACDYLLKPVRIEELRN 131 >gb|EXB38648.1| Two-component response regulator [Morus notabilis] Length = 674 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +1 Query: 364 SGNGDTKLVMKGITHGACDYLLKPVRIEELWN 459 S NGDT+LVMKGITHGACDYLLKP+RIEEL N Sbjct: 97 SANGDTRLVMKGITHGACDYLLKPIRIEELKN 128 >ref|XP_004954220.1| PREDICTED: two-component response regulator ARR12-like [Setaria italica] Length = 679 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +1 Query: 364 SGNGDTKLVMKGITHGACDYLLKPVRIEELWN 459 SGNG+TK VMKGITHGACDYLLKPVR+EEL N Sbjct: 100 SGNGETKTVMKGITHGACDYLLKPVRLEELRN 131 >ref|XP_006587150.1| PREDICTED: two-component response regulator ARR12 isoform X2 [Glycine max] Length = 654 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +1 Query: 364 SGNGDTKLVMKGITHGACDYLLKPVRIEELWN 459 S +GDTKLVMKG+THGACDYLLKPVRIEEL N Sbjct: 98 SAHGDTKLVMKGVTHGACDYLLKPVRIEELKN 129 >ref|XP_003533888.2| PREDICTED: two-component response regulator ARR12 isoform X1 [Glycine max] Length = 698 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +1 Query: 364 SGNGDTKLVMKGITHGACDYLLKPVRIEELWN 459 S +GDTKLVMKG+THGACDYLLKPVRIEEL N Sbjct: 98 SAHGDTKLVMKGVTHGACDYLLKPVRIEELKN 129 >ref|XP_002308698.2| hypothetical protein POPTR_0006s27800g [Populus trichocarpa] gi|550337222|gb|EEE92221.2| hypothetical protein POPTR_0006s27800g [Populus trichocarpa] Length = 682 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = +1 Query: 364 SGNGDTKLVMKGITHGACDYLLKPVRIEELWN 459 S NGD KLVMKGITHGACDYLLKPVRIEEL N Sbjct: 98 SANGDPKLVMKGITHGACDYLLKPVRIEELKN 129 >ref|XP_004157093.1| PREDICTED: LOW QUALITY PROTEIN: two-component response regulator ARR12-like [Cucumis sativus] Length = 688 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = +1 Query: 364 SGNGDTKLVMKGITHGACDYLLKPVRIEELWN 459 S NGD KLVMKGITHGACDYLLKPVRIEEL N Sbjct: 97 SANGDPKLVMKGITHGACDYLLKPVRIEELKN 128 >ref|XP_004145510.1| PREDICTED: two-component response regulator ARR12-like [Cucumis sativus] Length = 688 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = +1 Query: 364 SGNGDTKLVMKGITHGACDYLLKPVRIEELWN 459 S NGD KLVMKGITHGACDYLLKPVRIEEL N Sbjct: 97 SANGDPKLVMKGITHGACDYLLKPVRIEELKN 128 >ref|XP_003546612.1| PREDICTED: two-component response regulator ARR12-like [Glycine max] Length = 697 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +1 Query: 364 SGNGDTKLVMKGITHGACDYLLKPVRIEELWN 459 S +GDTKLVMKG+THGACDYLLKPVRIEEL N Sbjct: 98 SAHGDTKLVMKGVTHGACDYLLKPVRIEELKN 129 >gb|ACU18532.1| unknown [Glycine max] Length = 220 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +1 Query: 364 SGNGDTKLVMKGITHGACDYLLKPVRIEELWN 459 S +GDTKLVMKG+THGACDYLLKPVRIEEL N Sbjct: 98 SAHGDTKLVMKGVTHGACDYLLKPVRIEELKN 129 >ref|XP_007136967.1| hypothetical protein PHAVU_009G0889000g, partial [Phaseolus vulgaris] gi|561010054|gb|ESW08961.1| hypothetical protein PHAVU_009G0889000g, partial [Phaseolus vulgaris] Length = 425 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +1 Query: 364 SGNGDTKLVMKGITHGACDYLLKPVRIEELWN 459 S NGDTKLVMKGI+HGACDYLLKPVR+EEL N Sbjct: 97 SANGDTKLVMKGISHGACDYLLKPVRMEELKN 128 >ref|XP_003526216.1| PREDICTED: two-component response regulator ARR12 [Glycine max] Length = 696 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +1 Query: 364 SGNGDTKLVMKGITHGACDYLLKPVRIEELWN 459 S NGDTKLVMKGI+HGACDYLLKPVR+EEL N Sbjct: 97 SANGDTKLVMKGISHGACDYLLKPVRMEELKN 128 >ref|XP_006473989.1| PREDICTED: two-component response regulator ARR18-like [Citrus sinensis] Length = 681 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = +1 Query: 364 SGNGDTKLVMKGITHGACDYLLKPVRIEELWN 459 S GDTKLVMKGITHGACDYLLKPVRIEEL N Sbjct: 103 SAYGDTKLVMKGITHGACDYLLKPVRIEELKN 134 >ref|XP_006453634.1| hypothetical protein CICLE_v10007648mg [Citrus clementina] gi|557556860|gb|ESR66874.1| hypothetical protein CICLE_v10007648mg [Citrus clementina] Length = 681 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = +1 Query: 364 SGNGDTKLVMKGITHGACDYLLKPVRIEELWN 459 S GDTKLVMKGITHGACDYLLKPVRIEEL N Sbjct: 103 SAYGDTKLVMKGITHGACDYLLKPVRIEELKN 134