BLASTX nr result
ID: Akebia26_contig00011844
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00011844 (613 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002304342.2| hypothetical protein POPTR_0003s09250g [Popu... 57 4e-06 ref|XP_006385669.1| hypothetical protein POPTR_0003s09250g [Popu... 57 4e-06 ref|XP_006385667.1| hypothetical protein POPTR_0003s09250g [Popu... 57 4e-06 >ref|XP_002304342.2| hypothetical protein POPTR_0003s09250g [Populus trichocarpa] gi|550342805|gb|EEE79321.2| hypothetical protein POPTR_0003s09250g [Populus trichocarpa] Length = 305 Score = 57.0 bits (136), Expect = 4e-06 Identities = 24/33 (72%), Positives = 30/33 (90%), Gaps = 1/33 (3%) Frame = +1 Query: 1 ATAVIWREDRK-LTEDFQEKNWSDVNFCRKFKV 96 ATAVIWR+DRK +T DF E++WSD+NFCRKFK+ Sbjct: 130 ATAVIWRDDRKSITADFDERHWSDINFCRKFKL 162 >ref|XP_006385669.1| hypothetical protein POPTR_0003s09250g [Populus trichocarpa] gi|550342804|gb|ERP63466.1| hypothetical protein POPTR_0003s09250g [Populus trichocarpa] Length = 281 Score = 57.0 bits (136), Expect = 4e-06 Identities = 24/33 (72%), Positives = 30/33 (90%), Gaps = 1/33 (3%) Frame = +1 Query: 1 ATAVIWREDRK-LTEDFQEKNWSDVNFCRKFKV 96 ATAVIWR+DRK +T DF E++WSD+NFCRKFK+ Sbjct: 130 ATAVIWRDDRKSITADFDERHWSDINFCRKFKL 162 >ref|XP_006385667.1| hypothetical protein POPTR_0003s09250g [Populus trichocarpa] gi|566161746|ref|XP_006385668.1| hypothetical protein POPTR_0003s09250g [Populus trichocarpa] gi|550342802|gb|ERP63464.1| hypothetical protein POPTR_0003s09250g [Populus trichocarpa] gi|550342803|gb|ERP63465.1| hypothetical protein POPTR_0003s09250g [Populus trichocarpa] Length = 206 Score = 57.0 bits (136), Expect = 4e-06 Identities = 24/33 (72%), Positives = 30/33 (90%), Gaps = 1/33 (3%) Frame = +1 Query: 1 ATAVIWREDRK-LTEDFQEKNWSDVNFCRKFKV 96 ATAVIWR+DRK +T DF E++WSD+NFCRKFK+ Sbjct: 31 ATAVIWRDDRKSITADFDERHWSDINFCRKFKL 63