BLASTX nr result
ID: Akebia26_contig00011594
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00011594 (560 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW97773.1| cysteine protease inhibitor [Brassica oleracea va... 132 8e-29 gb|AAC37479.1| cysteine proteinase inhibitor [Brassica rapa subs... 132 8e-29 gb|AAL59842.1| cysteine protease inhibitor CPI-1 [Brassica olera... 132 8e-29 ref|XP_002267841.1| PREDICTED: cysteine proteinase inhibitor 12-... 131 1e-28 gb|ABG89856.1| cystatin [Amaranthus hypochondriacus] 130 3e-28 gb|AGX28139.1| cysteine protease inhibitor, partial [Populus eup... 129 4e-28 gb|EXB62705.1| Cysteine proteinase inhibitor 12 [Morus notabilis] 129 5e-28 pdb|4N6T|A Chain A, Adhiron: A Stable And Versatile Peptide Disp... 128 9e-28 ref|XP_006432368.1| hypothetical protein CICLE_v10002346mg [Citr... 128 1e-27 gb|AGX28141.1| cysteine protease inhibitor, partial [Populus eup... 128 1e-27 gb|AAY41807.1| cysteine proteinase inhibitor [Populus tomentosa] 128 1e-27 ref|XP_006471323.1| PREDICTED: cysteine proteinase inhibitor 12-... 127 1e-27 ref|XP_006407331.1| hypothetical protein EUTSA_v10021442mg [Eutr... 127 1e-27 gb|ACO39782.1| cysteine inhibitor 1 [Populus balsamifera] gi|226... 127 1e-27 gb|ACO39758.1| cysteine inhibitor 1 [Populus balsamifera] gi|226... 127 1e-27 ref|XP_002303955.1| cysteine proteinase inhibitor [Populus trich... 127 1e-27 ref|NP_850570.2| cysteine proteinase inhibitor 6 [Arabidopsis th... 127 2e-27 ref|XP_006298448.1| hypothetical protein CARUB_v10014520mg [Caps... 127 2e-27 gb|AAN65082.1| cysteine proteinase inhibitor, putative 1 [Arabid... 127 2e-27 gb|ABK78689.1| cysteine proteinase inhibitor [Brassica rapa] 127 2e-27 >gb|AFW97773.1| cysteine protease inhibitor [Brassica oleracea var. italica] Length = 205 Score = 132 bits (331), Expect = 8e-29 Identities = 63/75 (84%), Positives = 70/75 (93%) Frame = -1 Query: 500 SVEIESLAKFAVEEHNKKENALLEFARVLKAKEQVVSGTMHILTLEAIDGGAKKTYEAKV 321 SVE+ESLA+FAV+EHNKKENALLEFARV+KAKEQVV+GTMH LTLE I+ G KK YEAKV Sbjct: 16 SVEVESLARFAVDEHNKKENALLEFARVVKAKEQVVAGTMHHLTLEIIEAGKKKLYEAKV 75 Query: 320 WVKPWMNFKELQEFK 276 WVKPW+NFKELQEFK Sbjct: 76 WVKPWLNFKELQEFK 90 >gb|AAC37479.1| cysteine proteinase inhibitor [Brassica rapa subsp. oleifera] Length = 199 Score = 132 bits (331), Expect = 8e-29 Identities = 63/75 (84%), Positives = 70/75 (93%) Frame = -1 Query: 500 SVEIESLAKFAVEEHNKKENALLEFARVLKAKEQVVSGTMHILTLEAIDGGAKKTYEAKV 321 SVE+ESLA+FAV+EHNKKENALLEFARV+KAKEQVV+GTMH LTLE I+ G KK YEAKV Sbjct: 16 SVEVESLARFAVDEHNKKENALLEFARVVKAKEQVVAGTMHHLTLEIIEAGKKKLYEAKV 75 Query: 320 WVKPWMNFKELQEFK 276 WVKPW+NFKELQEFK Sbjct: 76 WVKPWLNFKELQEFK 90 >gb|AAL59842.1| cysteine protease inhibitor CPI-1 [Brassica oleracea] Length = 207 Score = 132 bits (331), Expect = 8e-29 Identities = 63/75 (84%), Positives = 70/75 (93%) Frame = -1 Query: 500 SVEIESLAKFAVEEHNKKENALLEFARVLKAKEQVVSGTMHILTLEAIDGGAKKTYEAKV 321 SVE+ESLA+FAV+EHNKKENALLEFARV+KAKEQVV+GTMH LTLE I+ G KK YEAKV Sbjct: 16 SVEVESLARFAVDEHNKKENALLEFARVVKAKEQVVAGTMHHLTLEIIEAGKKKLYEAKV 75 Query: 320 WVKPWMNFKELQEFK 276 WVKPW+NFKELQEFK Sbjct: 76 WVKPWLNFKELQEFK 90 >ref|XP_002267841.1| PREDICTED: cysteine proteinase inhibitor 12-like isoform 1 [Vitis vinifera] Length = 201 Score = 131 bits (329), Expect = 1e-28 Identities = 63/75 (84%), Positives = 69/75 (92%) Frame = -1 Query: 500 SVEIESLAKFAVEEHNKKENALLEFARVLKAKEQVVSGTMHILTLEAIDGGAKKTYEAKV 321 S EI+SLA+FAVEEHNKKENALLEFARV+KA+EQVV+GT+H LTLE ID G KK YEAKV Sbjct: 16 SAEIDSLARFAVEEHNKKENALLEFARVVKAEEQVVAGTLHHLTLEVIDAGRKKLYEAKV 75 Query: 320 WVKPWMNFKELQEFK 276 WVKPWMNFKELQEFK Sbjct: 76 WVKPWMNFKELQEFK 90 >gb|ABG89856.1| cystatin [Amaranthus hypochondriacus] Length = 247 Score = 130 bits (326), Expect = 3e-28 Identities = 62/76 (81%), Positives = 69/76 (90%) Frame = -1 Query: 494 EIESLAKFAVEEHNKKENALLEFARVLKAKEQVVSGTMHILTLEAIDGGAKKTYEAKVWV 315 EIESLA+FAV+EHNKKENALLEFARV+KAKEQVV+GT+H T+EAID G KK Y+AKVWV Sbjct: 59 EIESLARFAVDEHNKKENALLEFARVVKAKEQVVAGTLHHFTIEAIDAGKKKLYDAKVWV 118 Query: 314 KPWMNFKELQEFKLVE 267 KPWMNFKELQEFK E Sbjct: 119 KPWMNFKELQEFKHTE 134 >gb|AGX28139.1| cysteine protease inhibitor, partial [Populus euphratica] gi|549515974|gb|AGX28140.1| cysteine protease inhibitor, partial [Populus euphratica] Length = 107 Score = 129 bits (325), Expect = 4e-28 Identities = 61/75 (81%), Positives = 70/75 (93%) Frame = -1 Query: 500 SVEIESLAKFAVEEHNKKENALLEFARVLKAKEQVVSGTMHILTLEAIDGGAKKTYEAKV 321 SVEI+SLA+FAV+EHNKKENA+LEFARV+KAKEQVV+GTMH LT+EAI+ G KK YEAKV Sbjct: 16 SVEIDSLARFAVDEHNKKENAILEFARVVKAKEQVVAGTMHHLTIEAIEAGKKKLYEAKV 75 Query: 320 WVKPWMNFKELQEFK 276 WVKPW+NFKEL EFK Sbjct: 76 WVKPWLNFKELHEFK 90 >gb|EXB62705.1| Cysteine proteinase inhibitor 12 [Morus notabilis] Length = 239 Score = 129 bits (324), Expect = 5e-28 Identities = 60/75 (80%), Positives = 70/75 (93%) Frame = -1 Query: 500 SVEIESLAKFAVEEHNKKENALLEFARVLKAKEQVVSGTMHILTLEAIDGGAKKTYEAKV 321 S ++E LA+FAV+EHNKKENALLEFARV+KA+EQVV+GT+H LTLEAI+GG KK YEAKV Sbjct: 51 SADVEDLARFAVQEHNKKENALLEFARVVKAEEQVVAGTLHHLTLEAIEGGKKKIYEAKV 110 Query: 320 WVKPWMNFKELQEFK 276 WVKPW+NFKELQEFK Sbjct: 111 WVKPWLNFKELQEFK 125 >pdb|4N6T|A Chain A, Adhiron: A Stable And Versatile Peptide Display Scaffold - Full Length Adhiron gi|609412426|pdb|4N6U|A Chain A, Adhiron: A Stable And Versatile Peptide Display Scaffold - Truncated Adhiron Length = 79 Score = 128 bits (322), Expect = 9e-28 Identities = 63/77 (81%), Positives = 69/77 (89%) Frame = -1 Query: 500 SVEIESLAKFAVEEHNKKENALLEFARVLKAKEQVVSGTMHILTLEAIDGGAKKTYEAKV 321 S+EIE LA+FAV+EHNKKENALLEF RV+KAKEQVV+GTM+ LTLEA DGG KK YEAKV Sbjct: 3 SLEIEELARFAVDEHNKKENALLEFVRVVKAKEQVVAGTMYYLTLEAKDGGKKKLYEAKV 62 Query: 320 WVKPWMNFKELQEFKLV 270 WVKPW NFKELQEFK V Sbjct: 63 WVKPWENFKELQEFKPV 79 >ref|XP_006432368.1| hypothetical protein CICLE_v10002346mg [Citrus clementina] gi|557534490|gb|ESR45608.1| hypothetical protein CICLE_v10002346mg [Citrus clementina] Length = 235 Score = 128 bits (321), Expect = 1e-27 Identities = 61/77 (79%), Positives = 70/77 (90%) Frame = -1 Query: 500 SVEIESLAKFAVEEHNKKENALLEFARVLKAKEQVVSGTMHILTLEAIDGGAKKTYEAKV 321 S EIESLA+FA+EEHNKKENALLEF +V+KA+EQVV+GTMH LT+EAID G KK YEAKV Sbjct: 50 SNEIESLARFAIEEHNKKENALLEFVKVVKAQEQVVAGTMHHLTVEAIDAGTKKLYEAKV 109 Query: 320 WVKPWMNFKELQEFKLV 270 WVKPW+NFK+LQEFK V Sbjct: 110 WVKPWLNFKDLQEFKHV 126 >gb|AGX28141.1| cysteine protease inhibitor, partial [Populus euphratica] gi|549515981|gb|AGX28143.1| cysteine protease inhibitor, partial [Populus euphratica] gi|549515993|gb|AGX28144.1| cysteine protease inhibitor, partial [Populus pruinosa] gi|549515997|gb|AGX28145.1| cysteine protease inhibitor, partial [Populus pruinosa] gi|549515999|gb|AGX28146.1| cysteine protease inhibitor, partial [Populus pruinosa] gi|549516001|gb|AGX28147.1| cysteine protease inhibitor, partial [Populus pruinosa] gi|549516004|gb|AGX28148.1| cysteine protease inhibitor, partial [Populus pruinosa] gi|549516006|gb|AGX28149.1| cysteine protease inhibitor, partial [Populus pruinosa] gi|549516008|gb|AGX28150.1| cysteine protease inhibitor, partial [Populus pruinosa] gi|549516011|gb|AGX28151.1| cysteine protease inhibitor, partial [Populus pruinosa] gi|549516013|gb|AGX28152.1| cysteine protease inhibitor, partial [Populus pruinosa] Length = 107 Score = 128 bits (321), Expect = 1e-27 Identities = 60/75 (80%), Positives = 69/75 (92%) Frame = -1 Query: 500 SVEIESLAKFAVEEHNKKENALLEFARVLKAKEQVVSGTMHILTLEAIDGGAKKTYEAKV 321 S EI+SLA+FAV+EHNKKENA+LEFARV+KAKEQVV+GTMH LT+EAI+ G KK YEAKV Sbjct: 16 SAEIDSLARFAVDEHNKKENAILEFARVVKAKEQVVAGTMHHLTIEAIEAGKKKLYEAKV 75 Query: 320 WVKPWMNFKELQEFK 276 WVKPW+NFKEL EFK Sbjct: 76 WVKPWLNFKELHEFK 90 >gb|AAY41807.1| cysteine proteinase inhibitor [Populus tomentosa] Length = 143 Score = 128 bits (321), Expect = 1e-27 Identities = 60/75 (80%), Positives = 69/75 (92%) Frame = -1 Query: 500 SVEIESLAKFAVEEHNKKENALLEFARVLKAKEQVVSGTMHILTLEAIDGGAKKTYEAKV 321 S EI+SLA+FAV+EHNKKENA+LEFARV+KAKEQVV+GTMH LT+EAI+ G KK YEAKV Sbjct: 51 SAEIDSLARFAVDEHNKKENAILEFARVVKAKEQVVAGTMHHLTIEAIEAGKKKLYEAKV 110 Query: 320 WVKPWMNFKELQEFK 276 WVKPW+NFKEL EFK Sbjct: 111 WVKPWLNFKELHEFK 125 >ref|XP_006471323.1| PREDICTED: cysteine proteinase inhibitor 12-like [Citrus sinensis] Length = 235 Score = 127 bits (320), Expect = 1e-27 Identities = 61/77 (79%), Positives = 70/77 (90%) Frame = -1 Query: 500 SVEIESLAKFAVEEHNKKENALLEFARVLKAKEQVVSGTMHILTLEAIDGGAKKTYEAKV 321 S EIESLA+FA+EEHNKKENALLEF +V+KA+EQVV+GTMH LT+EAID G KK YEAKV Sbjct: 50 SNEIESLARFAIEEHNKKENALLEFVKVVKAQEQVVAGTMHHLTVEAIDAGRKKLYEAKV 109 Query: 320 WVKPWMNFKELQEFKLV 270 WVKPW+NFK+LQEFK V Sbjct: 110 WVKPWLNFKDLQEFKHV 126 >ref|XP_006407331.1| hypothetical protein EUTSA_v10021442mg [Eutrema salsugineum] gi|312282949|dbj|BAJ34340.1| unnamed protein product [Thellungiella halophila] gi|557108477|gb|ESQ48784.1| hypothetical protein EUTSA_v10021442mg [Eutrema salsugineum] Length = 234 Score = 127 bits (320), Expect = 1e-27 Identities = 60/75 (80%), Positives = 69/75 (92%) Frame = -1 Query: 500 SVEIESLAKFAVEEHNKKENALLEFARVLKAKEQVVSGTMHILTLEAIDGGAKKTYEAKV 321 S E+ESLA+FAV+EHNKKENALLEFARV+KAKEQVV+GT+H LTLE ++ G KK YEAKV Sbjct: 49 SDEVESLARFAVDEHNKKENALLEFARVVKAKEQVVAGTLHHLTLEIVEAGKKKLYEAKV 108 Query: 320 WVKPWMNFKELQEFK 276 WVKPW+NFKELQEFK Sbjct: 109 WVKPWLNFKELQEFK 123 >gb|ACO39782.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231580|gb|ACO39783.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231620|gb|ACO39803.1| cysteine inhibitor 1 [Populus balsamifera] Length = 127 Score = 127 bits (320), Expect = 1e-27 Identities = 59/75 (78%), Positives = 69/75 (92%) Frame = -1 Query: 500 SVEIESLAKFAVEEHNKKENALLEFARVLKAKEQVVSGTMHILTLEAIDGGAKKTYEAKV 321 S EI+SLA+FAV+EHNKKENA+LEFARV+KAKEQVV+GTMH LT+EA++ G KK YEAKV Sbjct: 35 SAEIDSLARFAVDEHNKKENAILEFARVVKAKEQVVAGTMHHLTIEAVEAGKKKLYEAKV 94 Query: 320 WVKPWMNFKELQEFK 276 WVKPW+NFKEL EFK Sbjct: 95 WVKPWLNFKELHEFK 109 >gb|ACO39758.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231532|gb|ACO39759.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231534|gb|ACO39760.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231536|gb|ACO39761.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231538|gb|ACO39762.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231540|gb|ACO39763.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231542|gb|ACO39764.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231544|gb|ACO39765.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231546|gb|ACO39766.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231548|gb|ACO39767.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231550|gb|ACO39768.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231552|gb|ACO39769.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231554|gb|ACO39770.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231556|gb|ACO39771.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231558|gb|ACO39772.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231560|gb|ACO39773.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231562|gb|ACO39774.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231564|gb|ACO39775.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231566|gb|ACO39776.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231568|gb|ACO39777.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231570|gb|ACO39778.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231572|gb|ACO39779.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231574|gb|ACO39780.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231576|gb|ACO39781.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231582|gb|ACO39784.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231584|gb|ACO39785.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231586|gb|ACO39786.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231588|gb|ACO39787.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231590|gb|ACO39788.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231592|gb|ACO39789.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231594|gb|ACO39790.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231596|gb|ACO39791.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231598|gb|ACO39792.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231602|gb|ACO39794.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231604|gb|ACO39795.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231606|gb|ACO39796.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231608|gb|ACO39797.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231610|gb|ACO39798.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231612|gb|ACO39799.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231614|gb|ACO39800.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231616|gb|ACO39801.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231618|gb|ACO39802.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231622|gb|ACO39804.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231624|gb|ACO39805.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231626|gb|ACO39806.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231628|gb|ACO39807.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231630|gb|ACO39808.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231632|gb|ACO39809.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231634|gb|ACO39810.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231636|gb|ACO39811.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231638|gb|ACO39812.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231640|gb|ACO39813.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231642|gb|ACO39814.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231644|gb|ACO39815.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231646|gb|ACO39816.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231648|gb|ACO39817.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231650|gb|ACO39818.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231652|gb|ACO39819.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231654|gb|ACO39820.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231656|gb|ACO39821.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231658|gb|ACO39822.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231660|gb|ACO39823.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231662|gb|ACO39824.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231664|gb|ACO39825.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231666|gb|ACO39826.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231668|gb|ACO39827.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231670|gb|ACO39828.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231672|gb|ACO39829.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231674|gb|ACO39830.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231676|gb|ACO39831.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231678|gb|ACO39832.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231680|gb|ACO39833.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231682|gb|ACO39834.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231684|gb|ACO39835.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231686|gb|ACO39836.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231688|gb|ACO39837.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231690|gb|ACO39838.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231692|gb|ACO39839.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231694|gb|ACO39840.1| cysteine inhibitor 1 [Populus balsamifera] gi|226231696|gb|ACO39841.1| cysteine inhibitor 1 [Populus balsamifera] Length = 127 Score = 127 bits (320), Expect = 1e-27 Identities = 59/75 (78%), Positives = 69/75 (92%) Frame = -1 Query: 500 SVEIESLAKFAVEEHNKKENALLEFARVLKAKEQVVSGTMHILTLEAIDGGAKKTYEAKV 321 S EI+SLA+FAV+EHNKKENA+LEFARV+KAKEQVV+GTMH LT+EA++ G KK YEAKV Sbjct: 35 SAEIDSLARFAVDEHNKKENAILEFARVVKAKEQVVAGTMHHLTIEAVEAGKKKLYEAKV 94 Query: 320 WVKPWMNFKELQEFK 276 WVKPW+NFKEL EFK Sbjct: 95 WVKPWLNFKELHEFK 109 >ref|XP_002303955.1| cysteine proteinase inhibitor [Populus trichocarpa] gi|222841387|gb|EEE78934.1| cysteine proteinase inhibitor [Populus trichocarpa] Length = 235 Score = 127 bits (320), Expect = 1e-27 Identities = 59/75 (78%), Positives = 69/75 (92%) Frame = -1 Query: 500 SVEIESLAKFAVEEHNKKENALLEFARVLKAKEQVVSGTMHILTLEAIDGGAKKTYEAKV 321 S EI+SLA+FAV+EHNKKENA+LEFARV+KAKEQVV+GTMH LT+EA++ G KK YEAKV Sbjct: 51 SAEIDSLARFAVDEHNKKENAILEFARVVKAKEQVVAGTMHHLTIEAVEAGKKKLYEAKV 110 Query: 320 WVKPWMNFKELQEFK 276 WVKPW+NFKEL EFK Sbjct: 111 WVKPWLNFKELHEFK 125 >ref|NP_850570.2| cysteine proteinase inhibitor 6 [Arabidopsis thaliana] gi|125991833|sp|Q8H0X6.2|CYT6_ARATH RecName: Full=Cysteine proteinase inhibitor 6; Short=AtCYS-6; AltName: Full=PIP-M; AltName: Full=PRLI-interacting factor M; Flags: Precursor gi|12321971|gb|AAG51028.1|AC069474_27 cysteine proteinase inhibitor, putative; 65918-67271 [Arabidopsis thaliana] gi|15795168|dbj|BAB03156.1| cysteine proteinase inhibitor-like protein [Arabidopsis thaliana] gi|332641680|gb|AEE75201.1| cysteine proteinase inhibitor 6 [Arabidopsis thaliana] Length = 234 Score = 127 bits (319), Expect = 2e-27 Identities = 60/75 (80%), Positives = 69/75 (92%) Frame = -1 Query: 500 SVEIESLAKFAVEEHNKKENALLEFARVLKAKEQVVSGTMHILTLEAIDGGAKKTYEAKV 321 S E+ESLA+FAV+EHNKKENALLEFARV+KAKEQVV+GT+H LTLE ++ G KK YEAKV Sbjct: 49 SGEVESLARFAVDEHNKKENALLEFARVVKAKEQVVAGTLHHLTLEILEAGQKKLYEAKV 108 Query: 320 WVKPWMNFKELQEFK 276 WVKPW+NFKELQEFK Sbjct: 109 WVKPWLNFKELQEFK 123 >ref|XP_006298448.1| hypothetical protein CARUB_v10014520mg [Capsella rubella] gi|482567157|gb|EOA31346.1| hypothetical protein CARUB_v10014520mg [Capsella rubella] Length = 236 Score = 127 bits (319), Expect = 2e-27 Identities = 60/75 (80%), Positives = 69/75 (92%) Frame = -1 Query: 500 SVEIESLAKFAVEEHNKKENALLEFARVLKAKEQVVSGTMHILTLEAIDGGAKKTYEAKV 321 S E+ESLA+FAV+EHNKKENALLEFARV+KAKEQVV+GT+H LTLE ++ G KK YEAKV Sbjct: 54 SGEVESLARFAVDEHNKKENALLEFARVVKAKEQVVAGTLHHLTLEILEAGQKKLYEAKV 113 Query: 320 WVKPWMNFKELQEFK 276 WVKPW+NFKELQEFK Sbjct: 114 WVKPWLNFKELQEFK 128 >gb|AAN65082.1| cysteine proteinase inhibitor, putative 1 [Arabidopsis thaliana] Length = 201 Score = 127 bits (319), Expect = 2e-27 Identities = 60/75 (80%), Positives = 69/75 (92%) Frame = -1 Query: 500 SVEIESLAKFAVEEHNKKENALLEFARVLKAKEQVVSGTMHILTLEAIDGGAKKTYEAKV 321 S E+ESLA+FAV+EHNKKENALLEFARV+KAKEQVV+GT+H LTLE ++ G KK YEAKV Sbjct: 16 SGEVESLARFAVDEHNKKENALLEFARVVKAKEQVVAGTLHHLTLEILEAGQKKLYEAKV 75 Query: 320 WVKPWMNFKELQEFK 276 WVKPW+NFKELQEFK Sbjct: 76 WVKPWLNFKELQEFK 90 >gb|ABK78689.1| cysteine proteinase inhibitor [Brassica rapa] Length = 202 Score = 127 bits (319), Expect = 2e-27 Identities = 60/75 (80%), Positives = 68/75 (90%) Frame = -1 Query: 500 SVEIESLAKFAVEEHNKKENALLEFARVLKAKEQVVSGTMHILTLEAIDGGAKKTYEAKV 321 S E+ESLA+FAV+EHNKKEN LLEFARV+KAKEQVV+GTMH LTLE ++ G KK YEAKV Sbjct: 16 SDEVESLARFAVDEHNKKENVLLEFARVVKAKEQVVAGTMHHLTLEIVEAGKKKLYEAKV 75 Query: 320 WVKPWMNFKELQEFK 276 WVKPW+NFKELQEFK Sbjct: 76 WVKPWLNFKELQEFK 90