BLASTX nr result
ID: Akebia26_contig00011575
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00011575 (323 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511371.1| protein phosphatase pp2a regulatory subunit ... 65 1e-08 ref|XP_006841047.1| hypothetical protein AMTR_s00085p00151790 [A... 65 1e-08 gb|ACN27831.1| unknown [Zea mays] gi|413926086|gb|AFW66018.1| hy... 62 6e-08 ref|NP_001132258.1| uncharacterized protein LOC100193694 [Zea ma... 62 6e-08 ref|XP_001768125.1| predicted protein [Physcomitrella patens] gi... 62 1e-07 gb|AFG71079.1| hypothetical protein 2_6145_01, partial [Pinus ta... 60 2e-07 gb|ADE77211.1| unknown [Picea sitchensis] 60 2e-07 ref|XP_004969080.1| PREDICTED: serine/threonine protein phosphat... 60 4e-07 ref|XP_004969079.1| PREDICTED: serine/threonine protein phosphat... 60 4e-07 gb|EMT07950.1| Serine/threonine protein phosphatase 2A 55 kDa re... 60 4e-07 dbj|BAD53433.1| type 2A protein serine/threonine phosphatase 55k... 60 4e-07 tpg|DAA58841.1| TPA: hypothetical protein ZEAMMB73_564286 [Zea m... 60 4e-07 gb|AFW83177.1| hypothetical protein ZEAMMB73_989132 [Zea mays] 60 4e-07 gb|AFW83176.1| hypothetical protein ZEAMMB73_989132 [Zea mays] 60 4e-07 ref|XP_002455899.1| hypothetical protein SORBIDRAFT_03g027000 [S... 60 4e-07 ref|NP_001169262.1| uncharacterized protein LOC100383125 [Zea ma... 60 4e-07 ref|NP_001130293.1| hypothetical protein [Zea mays] gi|194688766... 60 4e-07 gb|EAZ12582.1| hypothetical protein OsJ_02487 [Oryza sativa Japo... 60 4e-07 gb|EAY74822.1| hypothetical protein OsI_02712 [Oryza sativa Indi... 60 4e-07 ref|XP_006644337.1| PREDICTED: serine/threonine protein phosphat... 59 5e-07 >ref|XP_002511371.1| protein phosphatase pp2a regulatory subunit B, putative [Ricinus communis] gi|223550486|gb|EEF51973.1| protein phosphatase pp2a regulatory subunit B, putative [Ricinus communis] Length = 506 Score = 65.1 bits (157), Expect = 1e-08 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -1 Query: 323 CDLNSKLLHLAWHPTANLIACSTANSLYMYYA 228 CDL SKLLHLAWHPT N+IACS+ NSLYMYYA Sbjct: 475 CDLTSKLLHLAWHPTTNMIACSSGNSLYMYYA 506 >ref|XP_006841047.1| hypothetical protein AMTR_s00085p00151790 [Amborella trichopoda] gi|548842939|gb|ERN02722.1| hypothetical protein AMTR_s00085p00151790 [Amborella trichopoda] Length = 500 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -1 Query: 323 CDLNSKLLHLAWHPTANLIACSTANSLYMYYA 228 CDL KLLHLAWHPT+NLIAC++ANSLYMYYA Sbjct: 469 CDLTMKLLHLAWHPTSNLIACASANSLYMYYA 500 >gb|ACN27831.1| unknown [Zea mays] gi|413926086|gb|AFW66018.1| hypothetical protein ZEAMMB73_470489 [Zea mays] gi|413926087|gb|AFW66019.1| hypothetical protein ZEAMMB73_470489 [Zea mays] Length = 517 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -1 Query: 323 CDLNSKLLHLAWHPTANLIACSTANSLYMYYA 228 CDL++KLLHLAWHPT N IAC+ ANSLYMYYA Sbjct: 486 CDLSTKLLHLAWHPTENSIACAAANSLYMYYA 517 >ref|NP_001132258.1| uncharacterized protein LOC100193694 [Zea mays] gi|194693900|gb|ACF81034.1| unknown [Zea mays] Length = 320 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -1 Query: 323 CDLNSKLLHLAWHPTANLIACSTANSLYMYYA 228 CDL++KLLHLAWHPT N IAC+ ANSLYMYYA Sbjct: 289 CDLSTKLLHLAWHPTENSIACAAANSLYMYYA 320 >ref|XP_001768125.1| predicted protein [Physcomitrella patens] gi|162680563|gb|EDQ66998.1| predicted protein [Physcomitrella patens] Length = 505 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -1 Query: 320 DLNSKLLHLAWHPTANLIACSTANSLYMYYA 228 D +SKLLHLAWHPTANLIAC+ +NSLYMYYA Sbjct: 475 DFSSKLLHLAWHPTANLIACAASNSLYMYYA 505 >gb|AFG71079.1| hypothetical protein 2_6145_01, partial [Pinus taeda] gi|383175282|gb|AFG71080.1| hypothetical protein 2_6145_01, partial [Pinus taeda] gi|383175284|gb|AFG71081.1| hypothetical protein 2_6145_01, partial [Pinus taeda] gi|383175286|gb|AFG71082.1| hypothetical protein 2_6145_01, partial [Pinus taeda] gi|383175288|gb|AFG71083.1| hypothetical protein 2_6145_01, partial [Pinus taeda] gi|383175290|gb|AFG71084.1| hypothetical protein 2_6145_01, partial [Pinus taeda] gi|383175292|gb|AFG71085.1| hypothetical protein 2_6145_01, partial [Pinus taeda] gi|383175294|gb|AFG71086.1| hypothetical protein 2_6145_01, partial [Pinus taeda] gi|383175296|gb|AFG71087.1| hypothetical protein 2_6145_01, partial [Pinus taeda] gi|383175298|gb|AFG71088.1| hypothetical protein 2_6145_01, partial [Pinus taeda] gi|383175300|gb|AFG71089.1| hypothetical protein 2_6145_01, partial [Pinus taeda] gi|383175302|gb|AFG71090.1| hypothetical protein 2_6145_01, partial [Pinus taeda] Length = 68 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -1 Query: 320 DLNSKLLHLAWHPTANLIACSTANSLYMYYA 228 D NSKLLHLAWHP AN+IAC+ +NSLYMYYA Sbjct: 38 DFNSKLLHLAWHPAANVIACAASNSLYMYYA 68 >gb|ADE77211.1| unknown [Picea sitchensis] Length = 152 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -1 Query: 320 DLNSKLLHLAWHPTANLIACSTANSLYMYYA 228 D NSKLLHLAWHP AN+IAC+ +NSLYMYYA Sbjct: 122 DFNSKLLHLAWHPAANVIACAASNSLYMYYA 152 >ref|XP_004969080.1| PREDICTED: serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B beta isoform-like isoform X2 [Setaria italica] Length = 513 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -1 Query: 320 DLNSKLLHLAWHPTANLIACSTANSLYMYYA 228 DL++KLLHLAWHP+ NLIAC+ ANSLYMYYA Sbjct: 483 DLSTKLLHLAWHPSENLIACAAANSLYMYYA 513 >ref|XP_004969079.1| PREDICTED: serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B beta isoform-like isoform X1 [Setaria italica] Length = 514 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -1 Query: 320 DLNSKLLHLAWHPTANLIACSTANSLYMYYA 228 DL++KLLHLAWHP+ NLIAC+ ANSLYMYYA Sbjct: 484 DLSTKLLHLAWHPSENLIACAAANSLYMYYA 514 >gb|EMT07950.1| Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B beta isoform [Aegilops tauschii] Length = 514 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -1 Query: 320 DLNSKLLHLAWHPTANLIACSTANSLYMYYA 228 DL++KLLHLAWHP+ NLIAC+ ANSLYMYYA Sbjct: 484 DLSTKLLHLAWHPSENLIACAAANSLYMYYA 514 >dbj|BAD53433.1| type 2A protein serine/threonine phosphatase 55kDa B regulatory subunit-like [Oryza sativa Japonica Group] gi|53793534|dbj|BAD52983.1| type 2A protein serine/threonine phosphatase 55kDa B regulatory subunit-like [Oryza sativa Japonica Group] Length = 407 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -1 Query: 320 DLNSKLLHLAWHPTANLIACSTANSLYMYYA 228 DL++KLLHLAWHP+ NLIAC+ ANSLYMYYA Sbjct: 377 DLSTKLLHLAWHPSENLIACAAANSLYMYYA 407 >tpg|DAA58841.1| TPA: hypothetical protein ZEAMMB73_564286 [Zea mays] Length = 515 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -1 Query: 320 DLNSKLLHLAWHPTANLIACSTANSLYMYYA 228 DL++KLLHLAWHP+ NLIAC+ ANSLYMYYA Sbjct: 485 DLSTKLLHLAWHPSENLIACAAANSLYMYYA 515 >gb|AFW83177.1| hypothetical protein ZEAMMB73_989132 [Zea mays] Length = 235 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -1 Query: 320 DLNSKLLHLAWHPTANLIACSTANSLYMYYA 228 DL++KLLHLAWHP+ NLIAC+ ANSLYMYYA Sbjct: 205 DLSTKLLHLAWHPSENLIACAAANSLYMYYA 235 >gb|AFW83176.1| hypothetical protein ZEAMMB73_989132 [Zea mays] Length = 515 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -1 Query: 320 DLNSKLLHLAWHPTANLIACSTANSLYMYYA 228 DL++KLLHLAWHP+ NLIAC+ ANSLYMYYA Sbjct: 485 DLSTKLLHLAWHPSENLIACAAANSLYMYYA 515 >ref|XP_002455899.1| hypothetical protein SORBIDRAFT_03g027000 [Sorghum bicolor] gi|241927874|gb|EES01019.1| hypothetical protein SORBIDRAFT_03g027000 [Sorghum bicolor] Length = 515 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -1 Query: 320 DLNSKLLHLAWHPTANLIACSTANSLYMYYA 228 DL++KLLHLAWHP+ NLIAC+ ANSLYMYYA Sbjct: 485 DLSTKLLHLAWHPSENLIACAAANSLYMYYA 515 >ref|NP_001169262.1| uncharacterized protein LOC100383125 [Zea mays] gi|223975887|gb|ACN32131.1| unknown [Zea mays] gi|414881709|tpg|DAA58840.1| TPA: hypothetical protein ZEAMMB73_564286 [Zea mays] Length = 514 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -1 Query: 320 DLNSKLLHLAWHPTANLIACSTANSLYMYYA 228 DL++KLLHLAWHP+ NLIAC+ ANSLYMYYA Sbjct: 484 DLSTKLLHLAWHPSENLIACAAANSLYMYYA 514 >ref|NP_001130293.1| hypothetical protein [Zea mays] gi|194688766|gb|ACF78467.1| unknown [Zea mays] gi|413950526|gb|AFW83175.1| hypothetical protein ZEAMMB73_989132 [Zea mays] Length = 514 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -1 Query: 320 DLNSKLLHLAWHPTANLIACSTANSLYMYYA 228 DL++KLLHLAWHP+ NLIAC+ ANSLYMYYA Sbjct: 484 DLSTKLLHLAWHPSENLIACAAANSLYMYYA 514 >gb|EAZ12582.1| hypothetical protein OsJ_02487 [Oryza sativa Japonica Group] Length = 545 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -1 Query: 320 DLNSKLLHLAWHPTANLIACSTANSLYMYYA 228 DL++KLLHLAWHP+ NLIAC+ ANSLYMYYA Sbjct: 515 DLSTKLLHLAWHPSENLIACAAANSLYMYYA 545 >gb|EAY74822.1| hypothetical protein OsI_02712 [Oryza sativa Indica Group] Length = 507 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -1 Query: 320 DLNSKLLHLAWHPTANLIACSTANSLYMYYA 228 DL++KLLHLAWHP+ NLIAC+ ANSLYMYYA Sbjct: 477 DLSTKLLHLAWHPSENLIACAAANSLYMYYA 507 >ref|XP_006644337.1| PREDICTED: serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B beta isoform-like [Oryza brachyantha] Length = 485 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -1 Query: 320 DLNSKLLHLAWHPTANLIACSTANSLYMYYA 228 DL +KLLHLAWHP+ NLIAC+ ANSLYMYYA Sbjct: 455 DLTTKLLHLAWHPSENLIACAAANSLYMYYA 485