BLASTX nr result
ID: Akebia26_contig00011400
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00011400 (382 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003525917.1| PREDICTED: probable LRR receptor-like serine... 137 2e-30 ref|XP_004288716.1| PREDICTED: probable LRR receptor-like serine... 136 3e-30 ref|XP_002308399.2| leucine-rich repeat transmembrane protein ki... 135 6e-30 ref|XP_007203705.1| hypothetical protein PRUPE_ppa019670mg [Prun... 133 2e-29 ref|XP_006473994.1| PREDICTED: probable LRR receptor-like serine... 133 3e-29 ref|XP_007011944.1| Leucine-rich repeat protein kinase family pr... 132 4e-29 ref|XP_002532956.1| ATP binding protein, putative [Ricinus commu... 132 4e-29 ref|XP_002271577.1| PREDICTED: probable LRR receptor-like serine... 132 5e-29 emb|CAN70754.1| hypothetical protein VITISV_014698 [Vitis vinifera] 132 5e-29 ref|XP_006295855.1| hypothetical protein CARUB_v10024985mg [Caps... 132 7e-29 ref|XP_004166941.1| PREDICTED: probable LRR receptor-like serine... 131 9e-29 ref|XP_004152035.1| PREDICTED: probable LRR receptor-like serine... 131 9e-29 ref|XP_003518219.1| PREDICTED: probable LRR receptor-like serine... 131 9e-29 ref|XP_006453627.1| hypothetical protein CICLE_v10007429mg [Citr... 131 1e-28 ref|XP_006404924.1| hypothetical protein EUTSA_v10000045mg [Eutr... 131 1e-28 ref|XP_007138290.1| hypothetical protein PHAVU_009G195900g [Phas... 130 2e-28 gb|AAM13186.1| putative receptor-like protein kinase [Arabidopsi... 130 2e-28 ref|NP_850049.1| putative LRR receptor-like serine/threonine-pro... 130 2e-28 gb|AAD03384.1| putative receptor-like protein kinase [Arabidopsi... 130 2e-28 ref|XP_003549546.1| PREDICTED: probable LRR receptor-like serine... 130 3e-28 >ref|XP_003525917.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At2g24230-like [Glycine max] Length = 856 Score = 137 bits (344), Expect = 2e-30 Identities = 65/79 (82%), Positives = 73/79 (92%) Frame = -1 Query: 382 VGDDYPEEKELNLVSWVRGLVRKNQGSSAIDPKIRETGLETQMEEALRIGYLCTADLPTK 203 VGDDYP+EKE +LVSWVRGLVRKN+ S AIDPKIR+TG E QMEEAL+IGYLCTADLP+K Sbjct: 778 VGDDYPDEKEASLVSWVRGLVRKNKASRAIDPKIRDTGAEVQMEEALKIGYLCTADLPSK 837 Query: 202 RPSMQQIVGLLKDIEPSGH 146 RPSMQQIVGLLKDI+PS + Sbjct: 838 RPSMQQIVGLLKDIKPSAN 856 >ref|XP_004288716.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At2g24230-like [Fragaria vesca subsp. vesca] Length = 859 Score = 136 bits (342), Expect = 3e-30 Identities = 65/79 (82%), Positives = 74/79 (93%) Frame = -1 Query: 379 GDDYPEEKELNLVSWVRGLVRKNQGSSAIDPKIRETGLETQMEEALRIGYLCTADLPTKR 200 GDDYPE+K+ LVSWVRGLVRKN+ SSAIDPKIR+TG + QMEEAL+IGYLCTADLP+KR Sbjct: 781 GDDYPEDKDGTLVSWVRGLVRKNKVSSAIDPKIRDTGRDEQMEEALKIGYLCTADLPSKR 840 Query: 199 PSMQQIVGLLKDIEPSGHQ 143 PSMQQIVGLLKDIEP+G+Q Sbjct: 841 PSMQQIVGLLKDIEPTGNQ 859 >ref|XP_002308399.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa] gi|550336678|gb|EEE91922.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa] Length = 854 Score = 135 bits (340), Expect = 6e-30 Identities = 65/80 (81%), Positives = 71/80 (88%) Frame = -1 Query: 382 VGDDYPEEKELNLVSWVRGLVRKNQGSSAIDPKIRETGLETQMEEALRIGYLCTADLPTK 203 +GDDYP EK LVSWVRGLVRK+QGS AIDPKIR TG E +MEEAL+IGYLCTADLP+K Sbjct: 775 IGDDYPGEKNSTLVSWVRGLVRKSQGSRAIDPKIRNTGPEREMEEALKIGYLCTADLPSK 834 Query: 202 RPSMQQIVGLLKDIEPSGHQ 143 RPSMQQIVGLLKDIEP+ HQ Sbjct: 835 RPSMQQIVGLLKDIEPTTHQ 854 >ref|XP_007203705.1| hypothetical protein PRUPE_ppa019670mg [Prunus persica] gi|462399236|gb|EMJ04904.1| hypothetical protein PRUPE_ppa019670mg [Prunus persica] Length = 839 Score = 133 bits (335), Expect = 2e-29 Identities = 62/80 (77%), Positives = 73/80 (91%) Frame = -1 Query: 382 VGDDYPEEKELNLVSWVRGLVRKNQGSSAIDPKIRETGLETQMEEALRIGYLCTADLPTK 203 +GDDYPEEK+ LVSWVRGLV+KN+G+SAIDPKIR+TG + QMEEAL+IGYLCTADLP K Sbjct: 760 IGDDYPEEKDATLVSWVRGLVKKNRGASAIDPKIRDTGPDDQMEEALKIGYLCTADLPLK 819 Query: 202 RPSMQQIVGLLKDIEPSGHQ 143 RPSM QIVGLLKD+E +G+Q Sbjct: 820 RPSMHQIVGLLKDMEQTGNQ 839 >ref|XP_006473994.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At2g24230-like [Citrus sinensis] Length = 852 Score = 133 bits (334), Expect = 3e-29 Identities = 65/75 (86%), Positives = 69/75 (92%) Frame = -1 Query: 382 VGDDYPEEKELNLVSWVRGLVRKNQGSSAIDPKIRETGLETQMEEALRIGYLCTADLPTK 203 +GDDYPEEKE NLVSWVRGLVR N+GS AIDPKIR+TG E QMEEAL+IGYLCTADLP K Sbjct: 775 LGDDYPEEKEGNLVSWVRGLVRNNKGSRAIDPKIRDTGPEKQMEEALKIGYLCTADLPLK 834 Query: 202 RPSMQQIVGLLKDIE 158 RPSMQQIVGLLKDIE Sbjct: 835 RPSMQQIVGLLKDIE 849 >ref|XP_007011944.1| Leucine-rich repeat protein kinase family protein [Theobroma cacao] gi|508782307|gb|EOY29563.1| Leucine-rich repeat protein kinase family protein [Theobroma cacao] Length = 853 Score = 132 bits (333), Expect = 4e-29 Identities = 65/80 (81%), Positives = 70/80 (87%) Frame = -1 Query: 382 VGDDYPEEKELNLVSWVRGLVRKNQGSSAIDPKIRETGLETQMEEALRIGYLCTADLPTK 203 + DDY EE+E LVSWVRGLVRKNQGS AIDPKIR+TG + QMEEAL+IGYLCTADLPTK Sbjct: 774 IRDDYTEEQEATLVSWVRGLVRKNQGSRAIDPKIRDTGPDYQMEEALKIGYLCTADLPTK 833 Query: 202 RPSMQQIVGLLKDIEPSGHQ 143 RPSMQQIVGLLKDIEP Q Sbjct: 834 RPSMQQIVGLLKDIEPRAPQ 853 >ref|XP_002532956.1| ATP binding protein, putative [Ricinus communis] gi|223527266|gb|EEF29422.1| ATP binding protein, putative [Ricinus communis] Length = 839 Score = 132 bits (333), Expect = 4e-29 Identities = 64/80 (80%), Positives = 70/80 (87%) Frame = -1 Query: 382 VGDDYPEEKELNLVSWVRGLVRKNQGSSAIDPKIRETGLETQMEEALRIGYLCTADLPTK 203 +GDDYPEEK+ LVSWVRGLVRKNQ S AIDPKIR TG E +MEEAL+IGYLCTAD+P K Sbjct: 760 IGDDYPEEKDATLVSWVRGLVRKNQMSRAIDPKIRNTGPEQEMEEALKIGYLCTADIPLK 819 Query: 202 RPSMQQIVGLLKDIEPSGHQ 143 RPSMQQIVGLLKDIEP+ Q Sbjct: 820 RPSMQQIVGLLKDIEPTVRQ 839 >ref|XP_002271577.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At2g24230 [Vitis vinifera] Length = 853 Score = 132 bits (332), Expect = 5e-29 Identities = 65/80 (81%), Positives = 72/80 (90%) Frame = -1 Query: 382 VGDDYPEEKELNLVSWVRGLVRKNQGSSAIDPKIRETGLETQMEEALRIGYLCTADLPTK 203 +GDDYPE KE +LV+WVRGLVRKNQGS AIDPKIR TG + QMEEAL+IGYLCTADLP+K Sbjct: 775 IGDDYPE-KESSLVNWVRGLVRKNQGSRAIDPKIRGTGPDAQMEEALKIGYLCTADLPSK 833 Query: 202 RPSMQQIVGLLKDIEPSGHQ 143 RPSMQQIVGLLKDIEP H+ Sbjct: 834 RPSMQQIVGLLKDIEPVAHR 853 >emb|CAN70754.1| hypothetical protein VITISV_014698 [Vitis vinifera] Length = 114 Score = 132 bits (332), Expect = 5e-29 Identities = 65/80 (81%), Positives = 72/80 (90%) Frame = -1 Query: 382 VGDDYPEEKELNLVSWVRGLVRKNQGSSAIDPKIRETGLETQMEEALRIGYLCTADLPTK 203 +GDDYPE KE +LV+WVRGLVRKNQGS AIDPKIR TG + QMEEAL+IGYLCTADLP+K Sbjct: 36 IGDDYPE-KESSLVNWVRGLVRKNQGSRAIDPKIRGTGPDAQMEEALKIGYLCTADLPSK 94 Query: 202 RPSMQQIVGLLKDIEPSGHQ 143 RPSMQQIVGLLKDIEP H+ Sbjct: 95 RPSMQQIVGLLKDIEPVAHR 114 >ref|XP_006295855.1| hypothetical protein CARUB_v10024985mg [Capsella rubella] gi|482564563|gb|EOA28753.1| hypothetical protein CARUB_v10024985mg [Capsella rubella] Length = 852 Score = 132 bits (331), Expect = 7e-29 Identities = 63/80 (78%), Positives = 71/80 (88%) Frame = -1 Query: 382 VGDDYPEEKELNLVSWVRGLVRKNQGSSAIDPKIRETGLETQMEEALRIGYLCTADLPTK 203 + DDY +EK+ NLVSWVR LVRKNQGS AIDPKI+ETG E QMEEAL+IGYLCTADLP+K Sbjct: 773 IEDDYLDEKDANLVSWVRSLVRKNQGSKAIDPKIQETGSEDQMEEALKIGYLCTADLPSK 832 Query: 202 RPSMQQIVGLLKDIEPSGHQ 143 RPSMQQ+VGLLKDIEP +Q Sbjct: 833 RPSMQQVVGLLKDIEPKPNQ 852 >ref|XP_004166941.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At2g24230-like [Cucumis sativus] Length = 850 Score = 131 bits (330), Expect = 9e-29 Identities = 64/77 (83%), Positives = 69/77 (89%) Frame = -1 Query: 382 VGDDYPEEKELNLVSWVRGLVRKNQGSSAIDPKIRETGLETQMEEALRIGYLCTADLPTK 203 +GDDYPE KE +LVSWVRGLVRKNQG AIDPKIR TG + QMEEAL+I YLCTADLP+K Sbjct: 773 IGDDYPEGKEADLVSWVRGLVRKNQGLRAIDPKIRGTGPDDQMEEALKIAYLCTADLPSK 832 Query: 202 RPSMQQIVGLLKDIEPS 152 RPSMQQIVGLLKDIEPS Sbjct: 833 RPSMQQIVGLLKDIEPS 849 >ref|XP_004152035.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At2g24230-like, partial [Cucumis sativus] Length = 531 Score = 131 bits (330), Expect = 9e-29 Identities = 64/77 (83%), Positives = 69/77 (89%) Frame = -1 Query: 382 VGDDYPEEKELNLVSWVRGLVRKNQGSSAIDPKIRETGLETQMEEALRIGYLCTADLPTK 203 +GDDYPE KE +LVSWVRGLVRKNQG AIDPKIR TG + QMEEAL+I YLCTADLP+K Sbjct: 454 IGDDYPEGKEADLVSWVRGLVRKNQGLRAIDPKIRGTGPDDQMEEALKIAYLCTADLPSK 513 Query: 202 RPSMQQIVGLLKDIEPS 152 RPSMQQIVGLLKDIEPS Sbjct: 514 RPSMQQIVGLLKDIEPS 530 >ref|XP_003518219.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At2g24230-like [Glycine max] Length = 854 Score = 131 bits (330), Expect = 9e-29 Identities = 63/77 (81%), Positives = 69/77 (89%) Frame = -1 Query: 382 VGDDYPEEKELNLVSWVRGLVRKNQGSSAIDPKIRETGLETQMEEALRIGYLCTADLPTK 203 VGDDYP++KE LVSWVRGLVRKNQ S AIDPKI +TG + QMEEAL+IGYLCTADLP K Sbjct: 776 VGDDYPDDKEATLVSWVRGLVRKNQASRAIDPKIHDTGPDEQMEEALKIGYLCTADLPFK 835 Query: 202 RPSMQQIVGLLKDIEPS 152 RPSMQQIVGLLKDIEP+ Sbjct: 836 RPSMQQIVGLLKDIEPT 852 >ref|XP_006453627.1| hypothetical protein CICLE_v10007429mg [Citrus clementina] gi|557556853|gb|ESR66867.1| hypothetical protein CICLE_v10007429mg [Citrus clementina] Length = 853 Score = 131 bits (329), Expect = 1e-28 Identities = 64/74 (86%), Positives = 68/74 (91%) Frame = -1 Query: 382 VGDDYPEEKELNLVSWVRGLVRKNQGSSAIDPKIRETGLETQMEEALRIGYLCTADLPTK 203 +GDDYPEEKE NLVSWVRGLVR N+GS AIDPKIR+TG E QMEEAL+IGYLCTADLP K Sbjct: 780 LGDDYPEEKEGNLVSWVRGLVRNNKGSRAIDPKIRDTGPEKQMEEALKIGYLCTADLPLK 839 Query: 202 RPSMQQIVGLLKDI 161 RPSMQQIVGLLKDI Sbjct: 840 RPSMQQIVGLLKDI 853 >ref|XP_006404924.1| hypothetical protein EUTSA_v10000045mg [Eutrema salsugineum] gi|557106052|gb|ESQ46377.1| hypothetical protein EUTSA_v10000045mg [Eutrema salsugineum] Length = 851 Score = 131 bits (329), Expect = 1e-28 Identities = 62/80 (77%), Positives = 72/80 (90%) Frame = -1 Query: 382 VGDDYPEEKELNLVSWVRGLVRKNQGSSAIDPKIRETGLETQMEEALRIGYLCTADLPTK 203 + DDY +EK+++LVSWVR LVRKNQGS AIDPKI+ETG E QMEEAL+IGYLCTADLP+K Sbjct: 772 IEDDYLDEKDVDLVSWVRSLVRKNQGSKAIDPKIKETGSEDQMEEALKIGYLCTADLPSK 831 Query: 202 RPSMQQIVGLLKDIEPSGHQ 143 RPSMQQ+VGLLKDIEP +Q Sbjct: 832 RPSMQQVVGLLKDIEPKPNQ 851 >ref|XP_007138290.1| hypothetical protein PHAVU_009G195900g [Phaseolus vulgaris] gi|561011377|gb|ESW10284.1| hypothetical protein PHAVU_009G195900g [Phaseolus vulgaris] Length = 855 Score = 130 bits (327), Expect = 2e-28 Identities = 63/79 (79%), Positives = 69/79 (87%) Frame = -1 Query: 382 VGDDYPEEKELNLVSWVRGLVRKNQGSSAIDPKIRETGLETQMEEALRIGYLCTADLPTK 203 VGDDYP+ KE LVSWVRGLVR+N+ S AIDPKI TG E QMEEAL+IGYLCTA+LP+K Sbjct: 777 VGDDYPDVKEATLVSWVRGLVRENKASRAIDPKIHYTGAEEQMEEALKIGYLCTAELPSK 836 Query: 202 RPSMQQIVGLLKDIEPSGH 146 RPSMQQIVGLLKDIEPS H Sbjct: 837 RPSMQQIVGLLKDIEPSPH 855 >gb|AAM13186.1| putative receptor-like protein kinase [Arabidopsis thaliana] Length = 853 Score = 130 bits (327), Expect = 2e-28 Identities = 62/80 (77%), Positives = 70/80 (87%) Frame = -1 Query: 382 VGDDYPEEKELNLVSWVRGLVRKNQGSSAIDPKIRETGLETQMEEALRIGYLCTADLPTK 203 + DDY +EK+ NLVSWVR LVRKNQ S AIDPKI+ETG E QMEEAL+IGYLCTADLP+K Sbjct: 774 IEDDYLDEKDTNLVSWVRSLVRKNQASKAIDPKIQETGSEEQMEEALKIGYLCTADLPSK 833 Query: 202 RPSMQQIVGLLKDIEPSGHQ 143 RPSMQQ+VGLLKDIEP +Q Sbjct: 834 RPSMQQVVGLLKDIEPKSNQ 853 >ref|NP_850049.1| putative LRR receptor-like serine/threonine-protein kinase [Arabidopsis thaliana] gi|264664501|sp|C0LGK9.1|Y2242_ARATH RecName: Full=Probable LRR receptor-like serine/threonine-protein kinase At2g24230; Flags: Precursor gi|224589521|gb|ACN59294.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis thaliana] gi|330252452|gb|AEC07546.1| putative LRR receptor-like serine/threonine-protein kinase [Arabidopsis thaliana] Length = 853 Score = 130 bits (327), Expect = 2e-28 Identities = 62/80 (77%), Positives = 70/80 (87%) Frame = -1 Query: 382 VGDDYPEEKELNLVSWVRGLVRKNQGSSAIDPKIRETGLETQMEEALRIGYLCTADLPTK 203 + DDY +EK+ NLVSWVR LVRKNQ S AIDPKI+ETG E QMEEAL+IGYLCTADLP+K Sbjct: 774 IEDDYLDEKDTNLVSWVRSLVRKNQASKAIDPKIQETGSEEQMEEALKIGYLCTADLPSK 833 Query: 202 RPSMQQIVGLLKDIEPSGHQ 143 RPSMQQ+VGLLKDIEP +Q Sbjct: 834 RPSMQQVVGLLKDIEPKSNQ 853 >gb|AAD03384.1| putative receptor-like protein kinase [Arabidopsis thaliana] Length = 809 Score = 130 bits (327), Expect = 2e-28 Identities = 62/80 (77%), Positives = 70/80 (87%) Frame = -1 Query: 382 VGDDYPEEKELNLVSWVRGLVRKNQGSSAIDPKIRETGLETQMEEALRIGYLCTADLPTK 203 + DDY +EK+ NLVSWVR LVRKNQ S AIDPKI+ETG E QMEEAL+IGYLCTADLP+K Sbjct: 730 IEDDYLDEKDTNLVSWVRSLVRKNQASKAIDPKIQETGSEEQMEEALKIGYLCTADLPSK 789 Query: 202 RPSMQQIVGLLKDIEPSGHQ 143 RPSMQQ+VGLLKDIEP +Q Sbjct: 790 RPSMQQVVGLLKDIEPKSNQ 809 >ref|XP_003549546.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At2g24230-like [Glycine max] Length = 853 Score = 130 bits (326), Expect = 3e-28 Identities = 62/78 (79%), Positives = 70/78 (89%) Frame = -1 Query: 382 VGDDYPEEKELNLVSWVRGLVRKNQGSSAIDPKIRETGLETQMEEALRIGYLCTADLPTK 203 + DDYP++KE LVSWVRGLVRKNQ S AIDPKIR+TG + Q+EEAL+IGYLCTADLP K Sbjct: 776 IEDDYPDDKEETLVSWVRGLVRKNQASRAIDPKIRDTGPDEQIEEALKIGYLCTADLPFK 835 Query: 202 RPSMQQIVGLLKDIEPSG 149 RPSMQQIVGLLKDIEP+G Sbjct: 836 RPSMQQIVGLLKDIEPTG 853