BLASTX nr result
ID: Akebia26_contig00011369
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00011369 (435 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI37991.3| unnamed protein product [Vitis vinifera] 73 4e-11 ref|XP_002267638.1| PREDICTED: coenzyme Q-binding protein COQ10 ... 73 4e-11 ref|XP_004970126.1| PREDICTED: coenzyme Q-binding protein COQ10 ... 71 1e-10 ref|XP_006473323.1| PREDICTED: coenzyme Q-binding protein COQ10 ... 71 2e-10 ref|XP_006434763.1| hypothetical protein CICLE_v10002229mg [Citr... 71 2e-10 ref|XP_002510213.1| Protein COQ10 B, mitochondrial precursor, pu... 70 3e-10 ref|XP_004238155.1| PREDICTED: coenzyme Q-binding protein COQ10 ... 68 1e-09 ref|NP_001241970.1| uncharacterized protein LOC100816152 [Glycin... 68 1e-09 ref|XP_002456421.1| hypothetical protein SORBIDRAFT_03g035980 [S... 68 1e-09 gb|ACU19264.1| unknown [Glycine max] 68 2e-09 ref|XP_003523942.1| PREDICTED: coenzyme Q-binding protein COQ10 ... 68 2e-09 ref|XP_006578026.1| PREDICTED: coenzyme Q-binding protein COQ10 ... 67 3e-09 ref|XP_006354883.1| PREDICTED: coenzyme Q-binding protein COQ10 ... 66 4e-09 gb|EMT02238.1| hypothetical protein F775_27013 [Aegilops tauschii] 66 4e-09 ref|XP_002284753.1| PREDICTED: coenzyme Q-binding protein COQ10 ... 66 4e-09 ref|XP_006646377.1| PREDICTED: coenzyme Q-binding protein COQ10 ... 66 6e-09 gb|EEE55460.1| hypothetical protein OsJ_03622 [Oryza sativa Japo... 66 6e-09 gb|EAY75988.1| hypothetical protein OsI_03911 [Oryza sativa Indi... 66 6e-09 ref|NP_001044391.1| Os01g0772400 [Oryza sativa Japonica Group] g... 66 6e-09 ref|XP_003569927.1| PREDICTED: coenzyme Q-binding protein COQ10 ... 65 8e-09 >emb|CBI37991.3| unnamed protein product [Vitis vinifera] Length = 207 Score = 73.2 bits (178), Expect = 4e-11 Identities = 33/42 (78%), Positives = 40/42 (95%) Frame = -1 Query: 126 KQKKIIRHNDDGSFDAELKIGFKFLVESYVSHVELNKPKSIK 1 ++ +II+HN DGSFDAEL+IGFKFLVESYVSHVELN+PK+IK Sbjct: 82 QRSEIIKHNPDGSFDAELEIGFKFLVESYVSHVELNRPKTIK 123 >ref|XP_002267638.1| PREDICTED: coenzyme Q-binding protein COQ10 homolog, mitochondrial [Vitis vinifera] Length = 221 Score = 73.2 bits (178), Expect = 4e-11 Identities = 33/42 (78%), Positives = 40/42 (95%) Frame = -1 Query: 126 KQKKIIRHNDDGSFDAELKIGFKFLVESYVSHVELNKPKSIK 1 ++ +II+HN DGSFDAEL+IGFKFLVESYVSHVELN+PK+IK Sbjct: 96 QRSEIIKHNPDGSFDAELEIGFKFLVESYVSHVELNRPKTIK 137 >ref|XP_004970126.1| PREDICTED: coenzyme Q-binding protein COQ10 homolog A, mitochondrial-like [Setaria italica] Length = 254 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/42 (78%), Positives = 38/42 (90%) Frame = -1 Query: 126 KQKKIIRHNDDGSFDAELKIGFKFLVESYVSHVELNKPKSIK 1 ++ +IIR NDDGSFDAEL+IGFKFLVESYVSHVE+ KPK IK Sbjct: 129 QRSRIIRRNDDGSFDAELEIGFKFLVESYVSHVEMEKPKFIK 170 >ref|XP_006473323.1| PREDICTED: coenzyme Q-binding protein COQ10 homolog A, mitochondrial-like [Citrus sinensis] Length = 256 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/42 (73%), Positives = 39/42 (92%) Frame = -1 Query: 126 KQKKIIRHNDDGSFDAELKIGFKFLVESYVSHVELNKPKSIK 1 ++ +I++HN DGSFDAEL+IGFKFLVESYVSHVELN+PK +K Sbjct: 131 QRSEILKHNPDGSFDAELEIGFKFLVESYVSHVELNRPKFVK 172 >ref|XP_006434763.1| hypothetical protein CICLE_v10002229mg [Citrus clementina] gi|557536885|gb|ESR48003.1| hypothetical protein CICLE_v10002229mg [Citrus clementina] Length = 256 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/42 (73%), Positives = 39/42 (92%) Frame = -1 Query: 126 KQKKIIRHNDDGSFDAELKIGFKFLVESYVSHVELNKPKSIK 1 ++ +I++HN DGSFDAEL+IGFKFLVESYVSHVELN+PK +K Sbjct: 131 QRSEILKHNPDGSFDAELEIGFKFLVESYVSHVELNRPKFVK 172 >ref|XP_002510213.1| Protein COQ10 B, mitochondrial precursor, putative [Ricinus communis] gi|223550914|gb|EEF52400.1| Protein COQ10 B, mitochondrial precursor, putative [Ricinus communis] Length = 252 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/42 (76%), Positives = 38/42 (90%) Frame = -1 Query: 126 KQKKIIRHNDDGSFDAELKIGFKFLVESYVSHVELNKPKSIK 1 ++ IIRH+ DGSFDAEL+IGFKFLVESY+SHVEL +PKSIK Sbjct: 131 QRSDIIRHHPDGSFDAELEIGFKFLVESYISHVELKRPKSIK 172 >ref|XP_004238155.1| PREDICTED: coenzyme Q-binding protein COQ10 homolog, mitochondrial-like [Solanum lycopersicum] Length = 255 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/42 (76%), Positives = 38/42 (90%) Frame = -1 Query: 126 KQKKIIRHNDDGSFDAELKIGFKFLVESYVSHVELNKPKSIK 1 ++ +II+ + DGSFDAEL+IGFKFLVESYVSHVELNKPK IK Sbjct: 130 QRSEIIKRHPDGSFDAELEIGFKFLVESYVSHVELNKPKYIK 171 >ref|NP_001241970.1| uncharacterized protein LOC100816152 [Glycine max] gi|255642405|gb|ACU21466.1| unknown [Glycine max] Length = 255 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/42 (76%), Positives = 37/42 (88%) Frame = -1 Query: 126 KQKKIIRHNDDGSFDAELKIGFKFLVESYVSHVELNKPKSIK 1 ++ I+RH DGSFDAEL+IGFKFLVESYVSHVEL+KPK IK Sbjct: 130 QRSDILRHYPDGSFDAELEIGFKFLVESYVSHVELDKPKRIK 171 >ref|XP_002456421.1| hypothetical protein SORBIDRAFT_03g035980 [Sorghum bicolor] gi|241928396|gb|EES01541.1| hypothetical protein SORBIDRAFT_03g035980 [Sorghum bicolor] Length = 405 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/42 (73%), Positives = 38/42 (90%) Frame = -1 Query: 126 KQKKIIRHNDDGSFDAELKIGFKFLVESYVSHVELNKPKSIK 1 ++ +IIR +DDGSFDAEL+IGFKFLVESYVSHVE+ KP+ IK Sbjct: 280 QRSRIIRRHDDGSFDAELEIGFKFLVESYVSHVEMEKPRYIK 321 >gb|ACU19264.1| unknown [Glycine max] Length = 251 Score = 67.8 bits (164), Expect = 2e-09 Identities = 31/42 (73%), Positives = 38/42 (90%) Frame = -1 Query: 126 KQKKIIRHNDDGSFDAELKIGFKFLVESYVSHVELNKPKSIK 1 ++ +I+RH DGSFDAEL+IGFKFLVESYVSHVEL++PK IK Sbjct: 126 QRSEILRHYPDGSFDAELEIGFKFLVESYVSHVELDRPKRIK 167 >ref|XP_003523942.1| PREDICTED: coenzyme Q-binding protein COQ10 homolog B, mitochondrial isoform X1 [Glycine max] gi|83853823|gb|ABC47856.1| aromatic-rich family protein [Glycine max] Length = 251 Score = 67.8 bits (164), Expect = 2e-09 Identities = 31/42 (73%), Positives = 38/42 (90%) Frame = -1 Query: 126 KQKKIIRHNDDGSFDAELKIGFKFLVESYVSHVELNKPKSIK 1 ++ +I+RH DGSFDAEL+IGFKFLVESYVSHVEL++PK IK Sbjct: 126 QRSEILRHYPDGSFDAELEIGFKFLVESYVSHVELDRPKRIK 167 >ref|XP_006578026.1| PREDICTED: coenzyme Q-binding protein COQ10 homolog B, mitochondrial isoform X2 [Glycine max] Length = 226 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/39 (79%), Positives = 36/39 (92%) Frame = -1 Query: 117 KIIRHNDDGSFDAELKIGFKFLVESYVSHVELNKPKSIK 1 +I+RH DGSFDAEL+IGFKFLVESYVSHVEL++PK IK Sbjct: 104 EILRHYPDGSFDAELEIGFKFLVESYVSHVELDRPKRIK 142 >ref|XP_006354883.1| PREDICTED: coenzyme Q-binding protein COQ10 homolog, mitochondrial-like [Solanum tuberosum] Length = 254 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/42 (73%), Positives = 38/42 (90%) Frame = -1 Query: 126 KQKKIIRHNDDGSFDAELKIGFKFLVESYVSHVELNKPKSIK 1 ++ +II+ + DGSFDAEL+IGFKFLVESYVSHVEL+KPK IK Sbjct: 130 QRSEIIKRHPDGSFDAELEIGFKFLVESYVSHVELDKPKYIK 171 >gb|EMT02238.1| hypothetical protein F775_27013 [Aegilops tauschii] Length = 228 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = -1 Query: 126 KQKKIIRHNDDGSFDAELKIGFKFLVESYVSHVELNKPKSIK 1 ++ ++IR DDGSFDAEL+IGFKF VESYVSHVE+ KPK IK Sbjct: 34 QRSRVIRRYDDGSFDAELEIGFKFFVESYVSHVEMEKPKYIK 75 >ref|XP_002284753.1| PREDICTED: coenzyme Q-binding protein COQ10 homolog, mitochondrial [Vitis vinifera] gi|302142314|emb|CBI19517.3| unnamed protein product [Vitis vinifera] Length = 246 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/42 (73%), Positives = 37/42 (88%) Frame = -1 Query: 126 KQKKIIRHNDDGSFDAELKIGFKFLVESYVSHVELNKPKSIK 1 +Q +II+ DGSFDAEL+IGFKFLVE+YVSHVELN+PK IK Sbjct: 121 QQSEIIQRYPDGSFDAELEIGFKFLVENYVSHVELNRPKCIK 162 >ref|XP_006646377.1| PREDICTED: coenzyme Q-binding protein COQ10 homolog B, mitochondrial-like, partial [Oryza brachyantha] Length = 196 Score = 65.9 bits (159), Expect = 6e-09 Identities = 30/42 (71%), Positives = 38/42 (90%) Frame = -1 Query: 126 KQKKIIRHNDDGSFDAELKIGFKFLVESYVSHVELNKPKSIK 1 ++ +IIR +++GSFDAEL+IGFKFLVESYVSHVE+ KPK IK Sbjct: 71 QRSRIIRRHENGSFDAELEIGFKFLVESYVSHVEMKKPKYIK 112 >gb|EEE55460.1| hypothetical protein OsJ_03622 [Oryza sativa Japonica Group] Length = 144 Score = 65.9 bits (159), Expect = 6e-09 Identities = 30/42 (71%), Positives = 38/42 (90%) Frame = -1 Query: 126 KQKKIIRHNDDGSFDAELKIGFKFLVESYVSHVELNKPKSIK 1 ++ +IIR +++GSFDAEL+IGFKFLVESYVSHVE+ KPK IK Sbjct: 19 QRSRIIRRHENGSFDAELEIGFKFLVESYVSHVEMEKPKYIK 60 >gb|EAY75988.1| hypothetical protein OsI_03911 [Oryza sativa Indica Group] Length = 257 Score = 65.9 bits (159), Expect = 6e-09 Identities = 30/42 (71%), Positives = 38/42 (90%) Frame = -1 Query: 126 KQKKIIRHNDDGSFDAELKIGFKFLVESYVSHVELNKPKSIK 1 ++ +IIR +++GSFDAEL+IGFKFLVESYVSHVE+ KPK IK Sbjct: 132 QRSRIIRRHENGSFDAELEIGFKFLVESYVSHVEMEKPKYIK 173 >ref|NP_001044391.1| Os01g0772400 [Oryza sativa Japonica Group] gi|56785219|dbj|BAD82071.1| aromatic-rich family protein-like [Oryza sativa Japonica Group] gi|113533922|dbj|BAF06305.1| Os01g0772400 [Oryza sativa Japonica Group] Length = 257 Score = 65.9 bits (159), Expect = 6e-09 Identities = 30/42 (71%), Positives = 38/42 (90%) Frame = -1 Query: 126 KQKKIIRHNDDGSFDAELKIGFKFLVESYVSHVELNKPKSIK 1 ++ +IIR +++GSFDAEL+IGFKFLVESYVSHVE+ KPK IK Sbjct: 132 QRSRIIRRHENGSFDAELEIGFKFLVESYVSHVEMEKPKYIK 173 >ref|XP_003569927.1| PREDICTED: coenzyme Q-binding protein COQ10 homolog A, mitochondrial-like [Brachypodium distachyon] Length = 248 Score = 65.5 bits (158), Expect = 8e-09 Identities = 29/42 (69%), Positives = 37/42 (88%) Frame = -1 Query: 126 KQKKIIRHNDDGSFDAELKIGFKFLVESYVSHVELNKPKSIK 1 ++ +++R D+GSFDAEL+IGFKFLVESYVSHVE+ KPK IK Sbjct: 123 QRSRVVRRYDNGSFDAELEIGFKFLVESYVSHVEMEKPKYIK 164