BLASTX nr result
ID: Akebia26_contig00011364
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00011364 (274 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007220175.1| hypothetical protein PRUPE_ppa016549mg [Prun... 61 2e-07 >ref|XP_007220175.1| hypothetical protein PRUPE_ppa016549mg [Prunus persica] gi|462416637|gb|EMJ21374.1| hypothetical protein PRUPE_ppa016549mg [Prunus persica] Length = 182 Score = 60.8 bits (146), Expect = 2e-07 Identities = 31/51 (60%), Positives = 38/51 (74%) Frame = +1 Query: 121 TRKGRSYFGFLRFFSNPISPEAAAVRIIRNLRYFGLYYILVLWVILFVSLV 273 TRK R+ F L F+ P +PEAAAVRIIRNL YF LYYIL +W IL ++L+ Sbjct: 31 TRKTRNDFKLLFPFNIPATPEAAAVRIIRNLGYFRLYYILFIWTILSITLL 81