BLASTX nr result
ID: Akebia26_contig00009713
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00009713 (918 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN82757.1| hypothetical protein VITISV_013348 [Vitis vinifera] 51 3e-06 >emb|CAN82757.1| hypothetical protein VITISV_013348 [Vitis vinifera] Length = 1322 Score = 51.2 bits (121), Expect(3) = 3e-06 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +2 Query: 344 RVRFWKDHWCGSSPLREQFPGWFKMSLKKEALIS 445 RVRFWKD WCG PL E FP F +SL K+A +S Sbjct: 1137 RVRFWKDKWCGDEPLCESFPSLFSISLAKDAWVS 1170 Score = 24.3 bits (51), Expect(3) = 3e-06 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = +3 Query: 486 LVQERFNDGEVDSIARLVSSIESMALHLDDE 578 L FND E++ + R + I++ + +DE Sbjct: 1185 LFSRAFNDWEIEMVERFMLKIQAFRVQREDE 1215 Score = 21.9 bits (45), Expect(3) = 3e-06 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +1 Query: 598 NRSGVFSVKSFYHV 639 ++SG FSVKS Y + Sbjct: 1223 SKSGAFSVKSLYXI 1236