BLASTX nr result
ID: Akebia25_contig00067412
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00067412 (259 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006691365.1| hypothetical protein CTHT_0008370 [Chaetomiu... 118 8e-25 ref|XP_007290161.1| ring finger domain protein [Marssonina brunn... 117 2e-24 gb|EFW98674.1| ring finger domain protein [Grosmannia clavigera ... 113 3e-23 gb|ENH84333.1| ring finger domain-containing protein [Colletotri... 112 4e-23 gb|EMC92993.1| hypothetical protein BAUCODRAFT_269426 [Baudoinia... 112 5e-23 ref|XP_001938467.1| conserved hypothetical protein [Pyrenophora ... 112 5e-23 emb|CAB92694.2| conserved hypothetical protein [Neurospora crassa] 112 5e-23 ref|XP_956029.1| hypothetical protein NCU01715 [Neurospora crass... 112 5e-23 ref|XP_007284088.1| ring finger domain-containing protein [Colle... 112 7e-23 ref|XP_003350744.1| hypothetical protein SMAC_02415 [Sordaria ma... 112 7e-23 emb|CCF33925.1| hypothetical protein CH063_06017 [Colletotrichum... 111 9e-23 gb|ERT00029.1| hypothetical protein HMPREF1624_03398 [Sporothrix... 111 1e-22 ref|XP_003855750.1| hypothetical protein MYCGRDRAFT_117727 [Zymo... 111 1e-22 gb|EUN30940.1| hypothetical protein COCVIDRAFT_34484 [Bipolaris ... 110 2e-22 gb|EUC50286.1| hypothetical protein COCMIDRAFT_32380 [Bipolaris ... 110 2e-22 gb|EUC36990.1| hypothetical protein COCCADRAFT_1954 [Bipolaris z... 110 2e-22 gb|EON67792.1| hypothetical protein W97_07047 [Coniosporium apol... 110 2e-22 gb|EMD60794.1| hypothetical protein COCSADRAFT_39513 [Bipolaris ... 110 2e-22 gb|EPE31487.1| RING/U-box [Glarea lozoyensis ATCC 20868] 110 2e-22 gb|EHL02372.1| putative E3 ubiquitin-protein ligase SDIR1 [Glare... 110 2e-22 >ref|XP_006691365.1| hypothetical protein CTHT_0008370 [Chaetomium thermophilum var. thermophilum DSM 1495] gi|340992619|gb|EGS23174.1| hypothetical protein CTHT_0008370 [Chaetomium thermophilum var. thermophilum DSM 1495] Length = 632 Score = 118 bits (296), Expect = 8e-25 Identities = 53/83 (63%), Positives = 62/83 (74%) Frame = +1 Query: 1 ETSGTDGIAAAIVNSRDAKEAPKSDPTVPDQDSLGCSICTDDFEIGQDVRVLPCNHSFHP 180 E G G AA N+ + + KS+ D LGCSICTDDFE+G+DVRVLPCNH FHP Sbjct: 336 EGVGKTGTAAPQTNASSSADGRKSE------DRLGCSICTDDFEVGEDVRVLPCNHKFHP 389 Query: 181 ACIDPWLLNVSGTCPLCRIDLRP 249 ACIDPWL+N+SGTCPLCR+DLRP Sbjct: 390 ACIDPWLVNISGTCPLCRLDLRP 412 >ref|XP_007290161.1| ring finger domain protein [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406865995|gb|EKD19035.1| ring finger domain protein [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 515 Score = 117 bits (292), Expect = 2e-24 Identities = 55/104 (52%), Positives = 66/104 (63%), Gaps = 19/104 (18%) Frame = +1 Query: 4 TSGTDGIAAAIVNSRDAKEAPKS-------------------DPTVPDQDSLGCSICTDD 126 T GT +AAA +R+ + S D P++D+LGCSICT+D Sbjct: 298 TDGTTAVAAATTQTREGETRSSSETNSGPVGVATNAASVKSVDEASPNEDNLGCSICTED 357 Query: 127 FEIGQDVRVLPCNHSFHPACIDPWLLNVSGTCPLCRIDLRPASS 258 F G+DVRVLPCNH +HPACIDPWLLNVSGTCPLCR DLRP +S Sbjct: 358 FTTGEDVRVLPCNHKYHPACIDPWLLNVSGTCPLCRHDLRPPTS 401 >gb|EFW98674.1| ring finger domain protein [Grosmannia clavigera kw1407] Length = 507 Score = 113 bits (282), Expect = 3e-23 Identities = 46/71 (64%), Positives = 53/71 (74%) Frame = +1 Query: 37 VNSRDAKEAPKSDPTVPDQDSLGCSICTDDFEIGQDVRVLPCNHSFHPACIDPWLLNVSG 216 + D P SD D LGCSICT+DF +G+DVRVLPCNH FHP C+DPWL+NVSG Sbjct: 335 IGPADTAIGPSSDGLSQSDDHLGCSICTEDFTVGEDVRVLPCNHKFHPTCVDPWLVNVSG 394 Query: 217 TCPLCRIDLRP 249 TCPLCR+DLRP Sbjct: 395 TCPLCRLDLRP 405 >gb|ENH84333.1| ring finger domain-containing protein [Colletotrichum orbiculare MAFF 240422] Length = 509 Score = 112 bits (281), Expect = 4e-23 Identities = 49/83 (59%), Positives = 60/83 (72%) Frame = +1 Query: 1 ETSGTDGIAAAIVNSRDAKEAPKSDPTVPDQDSLGCSICTDDFEIGQDVRVLPCNHSFHP 180 ET+ A A+ EA + D +++LGCSICTDDF +G+DVRVLPCNH FHP Sbjct: 334 ETTAPKAPANAVATGAGNAEAERED-----EENLGCSICTDDFSVGEDVRVLPCNHKFHP 388 Query: 181 ACIDPWLLNVSGTCPLCRIDLRP 249 C+DPWL+NVSGTCPLCR+DLRP Sbjct: 389 NCVDPWLVNVSGTCPLCRLDLRP 411 >gb|EMC92993.1| hypothetical protein BAUCODRAFT_269426 [Baudoinia compniacensis UAMH 10762] Length = 558 Score = 112 bits (280), Expect = 5e-23 Identities = 53/77 (68%), Positives = 57/77 (74%) Frame = +1 Query: 19 GIAAAIVNSRDAKEAPKSDPTVPDQDSLGCSICTDDFEIGQDVRVLPCNHSFHPACIDPW 198 GIAAA VN P D+ GCSICT+DFE+GQD RVLPC+H FHPACIDPW Sbjct: 345 GIAAATVNEP------------PAADAQGCSICTEDFELGQDQRVLPCDHRFHPACIDPW 392 Query: 199 LLNVSGTCPLCRIDLRP 249 LLNVSGTCPLCRIDLRP Sbjct: 393 LLNVSGTCPLCRIDLRP 409 >ref|XP_001938467.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187985566|gb|EDU51054.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 570 Score = 112 bits (280), Expect = 5e-23 Identities = 51/80 (63%), Positives = 57/80 (71%) Frame = +1 Query: 19 GIAAAIVNSRDAKEAPKSDPTVPDQDSLGCSICTDDFEIGQDVRVLPCNHSFHPACIDPW 198 GIA A S A + DSLGCSICT+DFE GQD+RVLPC+H FHP C+DPW Sbjct: 369 GIAPA--QSAAAAAGATGTDNISSDDSLGCSICTEDFERGQDLRVLPCDHKFHPECVDPW 426 Query: 199 LLNVSGTCPLCRIDLRPASS 258 LLNVSGTCPLCR+DLRP S Sbjct: 427 LLNVSGTCPLCRVDLRPVQS 446 >emb|CAB92694.2| conserved hypothetical protein [Neurospora crassa] Length = 529 Score = 112 bits (280), Expect = 5e-23 Identities = 45/60 (75%), Positives = 53/60 (88%) Frame = +1 Query: 79 TVPDQDSLGCSICTDDFEIGQDVRVLPCNHSFHPACIDPWLLNVSGTCPLCRIDLRPASS 258 T PD +LGC ICT+DF IG+DVRVLPCNH +HPAC+DPWL+N+SGTCPLCR+DLRP SS Sbjct: 346 TTPDDINLGCPICTEDFTIGEDVRVLPCNHRYHPACVDPWLVNISGTCPLCRLDLRPHSS 405 >ref|XP_956029.1| hypothetical protein NCU01715 [Neurospora crassa OR74A] gi|28917071|gb|EAA26793.1| hypothetical protein NCU01715 [Neurospora crassa OR74A] Length = 537 Score = 112 bits (280), Expect = 5e-23 Identities = 45/60 (75%), Positives = 53/60 (88%) Frame = +1 Query: 79 TVPDQDSLGCSICTDDFEIGQDVRVLPCNHSFHPACIDPWLLNVSGTCPLCRIDLRPASS 258 T PD +LGC ICT+DF IG+DVRVLPCNH +HPAC+DPWL+N+SGTCPLCR+DLRP SS Sbjct: 346 TTPDDINLGCPICTEDFTIGEDVRVLPCNHRYHPACVDPWLVNISGTCPLCRLDLRPHSS 405 >ref|XP_007284088.1| ring finger domain-containing protein [Colletotrichum gloeosporioides Nara gc5] gi|429851692|gb|ELA26870.1| ring finger domain-containing protein [Colletotrichum gloeosporioides Nara gc5] Length = 468 Score = 112 bits (279), Expect = 7e-23 Identities = 45/69 (65%), Positives = 55/69 (79%) Frame = +1 Query: 43 SRDAKEAPKSDPTVPDQDSLGCSICTDDFEIGQDVRVLPCNHSFHPACIDPWLLNVSGTC 222 ++ A K D+++LGCSICTDDF +G+DVRVLPCNH FHP C+DPWL+NVSGTC Sbjct: 297 AKTAASDSKPKTAAQDEENLGCSICTDDFTVGEDVRVLPCNHKFHPNCVDPWLVNVSGTC 356 Query: 223 PLCRIDLRP 249 PLCR+DLRP Sbjct: 357 PLCRLDLRP 365 >ref|XP_003350744.1| hypothetical protein SMAC_02415 [Sordaria macrospora k-hell] gi|380094907|emb|CCC07409.1| unnamed protein product [Sordaria macrospora k-hell] Length = 534 Score = 112 bits (279), Expect = 7e-23 Identities = 46/69 (66%), Positives = 56/69 (81%) Frame = +1 Query: 52 AKEAPKSDPTVPDQDSLGCSICTDDFEIGQDVRVLPCNHSFHPACIDPWLLNVSGTCPLC 231 A A + T D +LGCSICT+DF +G+DVRVLPCNH +HPAC+DPWL+N+SGTCPLC Sbjct: 344 ANTAGSLENTSSDDINLGCSICTEDFTVGEDVRVLPCNHKYHPACVDPWLINISGTCPLC 403 Query: 232 RIDLRPASS 258 R+DLRP SS Sbjct: 404 RLDLRPHSS 412 >emb|CCF33925.1| hypothetical protein CH063_06017 [Colletotrichum higginsianum] Length = 513 Score = 111 bits (278), Expect = 9e-23 Identities = 47/83 (56%), Positives = 60/83 (72%) Frame = +1 Query: 1 ETSGTDGIAAAIVNSRDAKEAPKSDPTVPDQDSLGCSICTDDFEIGQDVRVLPCNHSFHP 180 + + T A A + DA + + + +SLGCSICT+DF +G+DVRVLPCNH FHP Sbjct: 329 DATKTTAGAVAXTTTTDAAGSSNPESGGQEDESLGCSICTEDFTVGEDVRVLPCNHKFHP 388 Query: 181 ACIDPWLLNVSGTCPLCRIDLRP 249 C+DPWL+NVSGTCPLCR+DLRP Sbjct: 389 NCVDPWLVNVSGTCPLCRLDLRP 411 >gb|ERT00029.1| hypothetical protein HMPREF1624_03398 [Sporothrix schenckii ATCC 58251] Length = 533 Score = 111 bits (277), Expect = 1e-22 Identities = 47/77 (61%), Positives = 57/77 (74%) Frame = +1 Query: 19 GIAAAIVNSRDAKEAPKSDPTVPDQDSLGCSICTDDFEIGQDVRVLPCNHSFHPACIDPW 198 G AA N+ +A + D LGCSICT+DFE+G+DVRVLPCNH +HP C+DPW Sbjct: 337 GAAAGTANAANASKDVGKAAEGEYGDHLGCSICTEDFEVGEDVRVLPCNHKYHPTCVDPW 396 Query: 199 LLNVSGTCPLCRIDLRP 249 L+NVSGTCPLCR+DLRP Sbjct: 397 LINVSGTCPLCRLDLRP 413 >ref|XP_003855750.1| hypothetical protein MYCGRDRAFT_117727 [Zymoseptoria tritici IPO323] gi|339475634|gb|EGP90726.1| hypothetical protein MYCGRDRAFT_117727 [Zymoseptoria tritici IPO323] Length = 551 Score = 111 bits (277), Expect = 1e-22 Identities = 54/84 (64%), Positives = 60/84 (71%) Frame = +1 Query: 4 TSGTDGIAAAIVNSRDAKEAPKSDPTVPDQDSLGCSICTDDFEIGQDVRVLPCNHSFHPA 183 T+ GIAAA + +P+ P+ GCSICTDDF +GQD RVLPCNH FHPA Sbjct: 325 TATPPGIAAATTTPPTNTSSSSEEPS-PE----GCSICTDDFILGQDQRVLPCNHRFHPA 379 Query: 184 CIDPWLLNVSGTCPLCRIDLRPAS 255 CIDPWLLNVSGTCPLCRIDLRP S Sbjct: 380 CIDPWLLNVSGTCPLCRIDLRPQS 403 >gb|EUN30940.1| hypothetical protein COCVIDRAFT_34484 [Bipolaris victoriae FI3] Length = 554 Score = 110 bits (276), Expect = 2e-22 Identities = 45/55 (81%), Positives = 50/55 (90%) Frame = +1 Query: 94 DSLGCSICTDDFEIGQDVRVLPCNHSFHPACIDPWLLNVSGTCPLCRIDLRPASS 258 +SLGCSICT+DFE GQD+RVLPCNH FHP C+DPWLLNVSGTCPLCR+DLRP S Sbjct: 363 ESLGCSICTEDFEKGQDLRVLPCNHKFHPECVDPWLLNVSGTCPLCRVDLRPVDS 417 >gb|EUC50286.1| hypothetical protein COCMIDRAFT_32380 [Bipolaris oryzae ATCC 44560] Length = 554 Score = 110 bits (276), Expect = 2e-22 Identities = 45/55 (81%), Positives = 50/55 (90%) Frame = +1 Query: 94 DSLGCSICTDDFEIGQDVRVLPCNHSFHPACIDPWLLNVSGTCPLCRIDLRPASS 258 +SLGCSICT+DFE GQD+RVLPCNH FHP C+DPWLLNVSGTCPLCR+DLRP S Sbjct: 363 ESLGCSICTEDFEKGQDLRVLPCNHKFHPECVDPWLLNVSGTCPLCRVDLRPVDS 417 >gb|EUC36990.1| hypothetical protein COCCADRAFT_1954 [Bipolaris zeicola 26-R-13] Length = 554 Score = 110 bits (276), Expect = 2e-22 Identities = 45/55 (81%), Positives = 50/55 (90%) Frame = +1 Query: 94 DSLGCSICTDDFEIGQDVRVLPCNHSFHPACIDPWLLNVSGTCPLCRIDLRPASS 258 +SLGCSICT+DFE GQD+RVLPCNH FHP C+DPWLLNVSGTCPLCR+DLRP S Sbjct: 363 ESLGCSICTEDFEKGQDLRVLPCNHKFHPECVDPWLLNVSGTCPLCRVDLRPVDS 417 >gb|EON67792.1| hypothetical protein W97_07047 [Coniosporium apollinis CBS 100218] Length = 541 Score = 110 bits (276), Expect = 2e-22 Identities = 50/82 (60%), Positives = 59/82 (71%) Frame = +1 Query: 13 TDGIAAAIVNSRDAKEAPKSDPTVPDQDSLGCSICTDDFEIGQDVRVLPCNHSFHPACID 192 T+ I A+V AP + D CSICTDDFE+GQD+RVLPCNH+FHPAC+D Sbjct: 317 TNAITPAVV------PAPTQAQDIVPDDYNTCSICTDDFELGQDIRVLPCNHTFHPACVD 370 Query: 193 PWLLNVSGTCPLCRIDLRPASS 258 PWLLNVSGTCPLCRI+L P +S Sbjct: 371 PWLLNVSGTCPLCRINLHPTAS 392 >gb|EMD60794.1| hypothetical protein COCSADRAFT_39513 [Bipolaris sorokiniana ND90Pr] Length = 554 Score = 110 bits (276), Expect = 2e-22 Identities = 45/55 (81%), Positives = 50/55 (90%) Frame = +1 Query: 94 DSLGCSICTDDFEIGQDVRVLPCNHSFHPACIDPWLLNVSGTCPLCRIDLRPASS 258 +SLGCSICT+DFE GQD+RVLPCNH FHP C+DPWLLNVSGTCPLCR+DLRP S Sbjct: 363 ESLGCSICTEDFEKGQDLRVLPCNHKFHPECVDPWLLNVSGTCPLCRVDLRPVDS 417 >gb|EPE31487.1| RING/U-box [Glarea lozoyensis ATCC 20868] Length = 523 Score = 110 bits (275), Expect = 2e-22 Identities = 51/90 (56%), Positives = 59/90 (65%), Gaps = 4/90 (4%) Frame = +1 Query: 1 ETSGTDGIAAAIVNSRDAKEAPKSDPTVP----DQDSLGCSICTDDFEIGQDVRVLPCNH 168 E + A A+ AK+AP D + LGCSICT+DF G+DVRVLPCNH Sbjct: 313 EANAVSTSATAVAEGGAAKDAPSGDAAASASSVQEGDLGCSICTEDFTTGEDVRVLPCNH 372 Query: 169 SFHPACIDPWLLNVSGTCPLCRIDLRPASS 258 +HPACIDPWLLNVSGTCPLCR DLR +S Sbjct: 373 KYHPACIDPWLLNVSGTCPLCRHDLRSDAS 402 >gb|EHL02372.1| putative E3 ubiquitin-protein ligase SDIR1 [Glarea lozoyensis 74030] Length = 183 Score = 110 bits (275), Expect = 2e-22 Identities = 51/90 (56%), Positives = 59/90 (65%), Gaps = 4/90 (4%) Frame = +1 Query: 1 ETSGTDGIAAAIVNSRDAKEAPKSDPTVP----DQDSLGCSICTDDFEIGQDVRVLPCNH 168 E + A A+ AK+AP D + LGCSICT+DF G+DVRVLPCNH Sbjct: 50 EANAVSTSATAVAEGGAAKDAPSGDAAASASSVQEGDLGCSICTEDFTTGEDVRVLPCNH 109 Query: 169 SFHPACIDPWLLNVSGTCPLCRIDLRPASS 258 +HPACIDPWLLNVSGTCPLCR DLR +S Sbjct: 110 KYHPACIDPWLLNVSGTCPLCRHDLRSDAS 139