BLASTX nr result
ID: Akebia25_contig00067333
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00067333 (359 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007589478.1| putative acyl binding protein [Neofusicoccum... 57 3e-06 gb|EON61666.1| hypothetical protein W97_00882 [Coniosporium apol... 55 8e-06 >ref|XP_007589478.1| putative acyl binding protein [Neofusicoccum parvum UCRNP2] gi|485915386|gb|EOD43055.1| putative acyl binding protein [Neofusicoccum parvum UCRNP2] Length = 332 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/72 (40%), Positives = 41/72 (56%) Frame = +3 Query: 144 RWRKKISSALIKLTAEVAALREQIESKRIGSANHNRRPTFLQWIWPYVDSXXXXXXXXXX 323 +WR+++ AL+K+TAEVAALREQ+ES+R+ H RR FL W+ +V Sbjct: 214 QWRRRVEQALVKMTAEVAALREQLESRRL--FQHTRRRRFLAWVGWFVWFIVKLIAADMV 271 Query: 324 XXXXXXXWLRRK 359 W+RRK Sbjct: 272 ILGIILLWMRRK 283 >gb|EON61666.1| hypothetical protein W97_00882 [Coniosporium apollinis CBS 100218] Length = 350 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/46 (54%), Positives = 37/46 (80%) Frame = +3 Query: 135 ESARWRKKISSALIKLTAEVAALREQIESKRIGSANHNRRPTFLQW 272 E ++WR+++ AL+K+TAEVAALREQ+ES+R+ S H+RR + L W Sbjct: 237 EESKWRRRVEQALVKMTAEVAALREQLESRRLFS--HSRRHSVLGW 280