BLASTX nr result
ID: Akebia25_contig00067162
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00067162 (241 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMR71389.1| putative methyltransferase type 11 protein [Eutyp... 56 6e-06 >gb|EMR71389.1| putative methyltransferase type 11 protein [Eutypa lata UCREL1] Length = 283 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/63 (38%), Positives = 35/63 (55%) Frame = +2 Query: 29 VKPYPKILACDFAQGMIDQLELRKQALGWDTVESLVRDAADLEGVPSNAFDFAIMNFGIF 208 V+P P++ D + M++Q A GW T E +V+D+ DL FD +MN GIF Sbjct: 74 VQPPPRVTGIDISPAMVEQFNSNISAHGWSTAEGIVQDSGDLSRFNDGEFDAVVMNLGIF 133 Query: 209 AVP 217 A+P Sbjct: 134 ALP 136