BLASTX nr result
ID: Akebia25_contig00067054
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00067054 (235 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003853299.1| hypothetical protein MYCGRDRAFT_71444 [Zymos... 102 4e-20 gb|EMC94689.1| hypothetical protein BAUCODRAFT_73681 [Baudoinia ... 100 3e-19 ref|XP_002148850.1| ankyrin repeat and BTB/POZ domain protein [... 94 2e-17 gb|EON68801.1| hypothetical protein W97_08059 [Coniosporium apol... 93 3e-17 gb|EME48871.1| hypothetical protein DOTSEDRAFT_67814, partial [D... 93 3e-17 gb|EQL31853.1| hypothetical protein, variant [Ajellomyces dermat... 91 1e-16 gb|EQL31852.1| hypothetical protein BDFG_05900 [Ajellomyces derm... 91 1e-16 gb|EME88369.1| hypothetical protein MYCFIDRAFT_28264 [Pseudocerc... 91 1e-16 gb|EGE83009.1| ankyrin repeat and BTB/POZ domain-containing prot... 91 1e-16 ref|XP_002620998.1| ankyrin repeat and BTB/POZ domain-containing... 91 1e-16 ref|XP_002485350.1| ankyrin repeat and BTB/POZ domain protein [... 89 8e-16 gb|EFW18922.1| BTB/POZ domain-containing protein Btb3 [Coccidioi... 88 1e-15 ref|XP_001239028.1| hypothetical protein CIMG_10050 [Coccidioide... 88 1e-15 ref|XP_003072019.1| BTB/POZ domain containing protein [Coccidioi... 87 2e-15 ref|XP_001797763.1| hypothetical protein SNOG_07430 [Phaeosphaer... 87 2e-15 ref|XP_007580177.1| putative ankyrin repeat and btb poz domain p... 86 5e-15 ref|XP_001257458.1| ankyrin repeat and BTB/POZ domain protein [N... 86 5e-15 ref|XP_747809.1| ankyrin repeat and BTB/POZ domain protein [Asp... 84 2e-14 gb|EMF17914.1| ankyrin repeat and BTB/POZ domain-containing prot... 84 2e-14 gb|EUN30670.1| hypothetical protein COCVIDRAFT_89819 [Bipolaris ... 83 4e-14 >ref|XP_003853299.1| hypothetical protein MYCGRDRAFT_71444 [Zymoseptoria tritici IPO323] gi|339473181|gb|EGP88275.1| hypothetical protein MYCGRDRAFT_71444 [Zymoseptoria tritici IPO323] Length = 630 Score = 102 bits (255), Expect = 4e-20 Identities = 47/64 (73%), Positives = 57/64 (89%) Frame = -3 Query: 233 IPQLFENILASGDRRLARQRRTEELERGRDQMTSWYENNVLKYKVRVQSDKANAVRWDRD 54 I Q+FE+ILASGDRR ARQRRTEE+ERGRDQ+ SW++NNVLKYKV + + KA+ V+WDRD Sbjct: 237 IQQVFEDILASGDRRQARQRRTEEVERGRDQLASWFQNNVLKYKVALDTAKADDVKWDRD 296 Query: 53 NGIF 42 NGIF Sbjct: 297 NGIF 300 >gb|EMC94689.1| hypothetical protein BAUCODRAFT_73681 [Baudoinia compniacensis UAMH 10762] Length = 652 Score = 100 bits (248), Expect = 3e-19 Identities = 46/64 (71%), Positives = 53/64 (82%) Frame = -3 Query: 233 IPQLFENILASGDRRLARQRRTEELERGRDQMTSWYENNVLKYKVRVQSDKANAVRWDRD 54 IP+LFENIL GDRR ARQRRTEELE+GRDQM W++ NVLK+KV V +KAN V+WDRD Sbjct: 238 IPELFENILHPGDRRQARQRRTEELEKGRDQMARWFQRNVLKHKVEVAREKANDVKWDRD 297 Query: 53 NGIF 42 N IF Sbjct: 298 NSIF 301 >ref|XP_002148850.1| ankyrin repeat and BTB/POZ domain protein [Talaromyces marneffei ATCC 18224] gi|210068592|gb|EEA22683.1| ankyrin repeat and BTB/POZ domain protein [Talaromyces marneffei ATCC 18224] Length = 656 Score = 94.4 bits (233), Expect = 2e-17 Identities = 42/64 (65%), Positives = 53/64 (82%) Frame = -3 Query: 233 IPQLFENILASGDRRLARQRRTEELERGRDQMTSWYENNVLKYKVRVQSDKANAVRWDRD 54 IP L + +L SGDRRLARQRRT+EL RGRDQ SW+ENN++++KV V++ KAN V+WDR Sbjct: 243 IPNLLDIVLESGDRRLARQRRTDELARGRDQFESWFENNIIRHKVVVETAKANDVKWDRS 302 Query: 53 NGIF 42 NGIF Sbjct: 303 NGIF 306 >gb|EON68801.1| hypothetical protein W97_08059 [Coniosporium apollinis CBS 100218] Length = 631 Score = 93.2 bits (230), Expect = 3e-17 Identities = 40/64 (62%), Positives = 55/64 (85%) Frame = -3 Query: 233 IPQLFENILASGDRRLARQRRTEELERGRDQMTSWYENNVLKYKVRVQSDKANAVRWDRD 54 I +LFE+IL GDRRLARQRRTEE+ RGRDQ+ +W++ NVL++K+ V + KA++VRWDR+ Sbjct: 235 IDRLFESILEGGDRRLARQRRTEEVNRGRDQLHTWFQQNVLRHKITVATSKADSVRWDRN 294 Query: 53 NGIF 42 NG+F Sbjct: 295 NGVF 298 >gb|EME48871.1| hypothetical protein DOTSEDRAFT_67814, partial [Dothistroma septosporum NZE10] Length = 610 Score = 93.2 bits (230), Expect = 3e-17 Identities = 39/64 (60%), Positives = 55/64 (85%) Frame = -3 Query: 233 IPQLFENILASGDRRLARQRRTEELERGRDQMTSWYENNVLKYKVRVQSDKANAVRWDRD 54 +P++FE+ILASGDRR RQRR + + +GRDQ+ +W++ NVL+YKVRV S+KA+ V+WD+D Sbjct: 237 VPEVFEDILASGDRRQTRQRREDGVRKGRDQLDAWFKRNVLQYKVRVDSEKADRVKWDKD 296 Query: 53 NGIF 42 NGIF Sbjct: 297 NGIF 300 >gb|EQL31853.1| hypothetical protein, variant [Ajellomyces dermatitidis ATCC 26199] Length = 504 Score = 91.3 bits (225), Expect = 1e-16 Identities = 42/64 (65%), Positives = 50/64 (78%) Frame = -3 Query: 233 IPQLFENILASGDRRLARQRRTEELERGRDQMTSWYENNVLKYKVRVQSDKANAVRWDRD 54 +P L E IL SGDRRL RQRR EE RGRDQM SW+ NVL++K+ V++DKAN V+W RD Sbjct: 58 LPGLVETILDSGDRRLTRQRRAEETSRGRDQMESWFRENVLQHKLVVETDKANKVKWPRD 117 Query: 53 NGIF 42 NGIF Sbjct: 118 NGIF 121 >gb|EQL31852.1| hypothetical protein BDFG_05900 [Ajellomyces dermatitidis ATCC 26199] Length = 689 Score = 91.3 bits (225), Expect = 1e-16 Identities = 42/64 (65%), Positives = 50/64 (78%) Frame = -3 Query: 233 IPQLFENILASGDRRLARQRRTEELERGRDQMTSWYENNVLKYKVRVQSDKANAVRWDRD 54 +P L E IL SGDRRL RQRR EE RGRDQM SW+ NVL++K+ V++DKAN V+W RD Sbjct: 243 LPGLVETILDSGDRRLTRQRRAEETSRGRDQMESWFRENVLQHKLVVETDKANKVKWPRD 302 Query: 53 NGIF 42 NGIF Sbjct: 303 NGIF 306 >gb|EME88369.1| hypothetical protein MYCFIDRAFT_28264 [Pseudocercospora fijiensis CIRAD86] Length = 616 Score = 91.3 bits (225), Expect = 1e-16 Identities = 42/64 (65%), Positives = 53/64 (82%) Frame = -3 Query: 233 IPQLFENILASGDRRLARQRRTEELERGRDQMTSWYENNVLKYKVRVQSDKANAVRWDRD 54 I QLF++ILASGDRR ARQRR EE+ RGR Q+ W+++NVL+ K+ V SDKA+ V+WDRD Sbjct: 238 IQQLFQDILASGDRRQARQRRQEEVSRGRGQVEQWFKSNVLQNKMTVDSDKADGVKWDRD 297 Query: 53 NGIF 42 NGIF Sbjct: 298 NGIF 301 >gb|EGE83009.1| ankyrin repeat and BTB/POZ domain-containing protein [Ajellomyces dermatitidis ATCC 18188] Length = 811 Score = 91.3 bits (225), Expect = 1e-16 Identities = 42/64 (65%), Positives = 50/64 (78%) Frame = -3 Query: 233 IPQLFENILASGDRRLARQRRTEELERGRDQMTSWYENNVLKYKVRVQSDKANAVRWDRD 54 +P L E IL SGDRRL RQRR EE RGRDQM SW+ NVL++K+ V++DKAN V+W RD Sbjct: 365 LPGLVETILDSGDRRLTRQRRAEETSRGRDQMESWFRENVLQHKLVVETDKANKVKWPRD 424 Query: 53 NGIF 42 NGIF Sbjct: 425 NGIF 428 >ref|XP_002620998.1| ankyrin repeat and BTB/POZ domain-containing protein [Ajellomyces dermatitidis SLH14081] gi|239591783|gb|EEQ74364.1| ankyrin repeat and BTB/POZ domain-containing protein [Ajellomyces dermatitidis SLH14081] gi|239614701|gb|EEQ91688.1| ankyrin repeat and BTB/POZ domain-containing protein [Ajellomyces dermatitidis ER-3] Length = 686 Score = 91.3 bits (225), Expect = 1e-16 Identities = 42/64 (65%), Positives = 50/64 (78%) Frame = -3 Query: 233 IPQLFENILASGDRRLARQRRTEELERGRDQMTSWYENNVLKYKVRVQSDKANAVRWDRD 54 +P L E IL SGDRRL RQRR EE RGRDQM SW+ NVL++K+ V++DKAN V+W RD Sbjct: 240 LPGLVETILDSGDRRLTRQRRAEETSRGRDQMESWFRENVLQHKLVVETDKANKVKWPRD 299 Query: 53 NGIF 42 NGIF Sbjct: 300 NGIF 303 >ref|XP_002485350.1| ankyrin repeat and BTB/POZ domain protein [Talaromyces stipitatus ATCC 10500] gi|218715975|gb|EED15397.1| ankyrin repeat and BTB/POZ domain protein [Talaromyces stipitatus ATCC 10500] Length = 643 Score = 88.6 bits (218), Expect = 8e-16 Identities = 42/64 (65%), Positives = 50/64 (78%) Frame = -3 Query: 233 IPQLFENILASGDRRLARQRRTEELERGRDQMTSWYENNVLKYKVRVQSDKANAVRWDRD 54 IP L +L SGDRRLARQRR +EL RGRDQ SW+E+NVL +KV V++ KAN V+WDR Sbjct: 243 IPNLLVIVLESGDRRLARQRRADELARGRDQFESWFESNVLGHKVVVETAKANDVKWDRS 302 Query: 53 NGIF 42 NGIF Sbjct: 303 NGIF 306 >gb|EFW18922.1| BTB/POZ domain-containing protein Btb3 [Coccidioides posadasii str. Silveira] Length = 672 Score = 87.8 bits (216), Expect = 1e-15 Identities = 38/61 (62%), Positives = 49/61 (80%) Frame = -3 Query: 224 LFENILASGDRRLARQRRTEELERGRDQMTSWYENNVLKYKVRVQSDKANAVRWDRDNGI 45 L + IL SGDRRLARQRRT+E+ +GRDQM +W++NNVL+YK V +DK N V+W RDN + Sbjct: 247 LMDTILDSGDRRLARQRRTDEVVKGRDQMETWFQNNVLRYKTVVDTDKLNEVKWSRDNNV 306 Query: 44 F 42 F Sbjct: 307 F 307 >ref|XP_001239028.1| hypothetical protein CIMG_10050 [Coccidioides immitis RS] gi|392869233|gb|EAS27731.2| ankyrin repeat and BTB/POZ domain-containing protein [Coccidioides immitis RS] Length = 672 Score = 87.8 bits (216), Expect = 1e-15 Identities = 38/61 (62%), Positives = 49/61 (80%) Frame = -3 Query: 224 LFENILASGDRRLARQRRTEELERGRDQMTSWYENNVLKYKVRVQSDKANAVRWDRDNGI 45 L + IL SGDRRLARQRRT+E+ +GRDQM +W++NNVL+YK V +DK N V+W RDN + Sbjct: 247 LMDTILDSGDRRLARQRRTDEVVKGRDQMETWFQNNVLRYKTVVDTDKLNEVKWSRDNNV 306 Query: 44 F 42 F Sbjct: 307 F 307 >ref|XP_003072019.1| BTB/POZ domain containing protein [Coccidioides posadasii C735 delta SOWgp] gi|240111729|gb|EER29874.1| BTB/POZ domain containing protein [Coccidioides posadasii C735 delta SOWgp] Length = 672 Score = 87.4 bits (215), Expect = 2e-15 Identities = 38/61 (62%), Positives = 49/61 (80%) Frame = -3 Query: 224 LFENILASGDRRLARQRRTEELERGRDQMTSWYENNVLKYKVRVQSDKANAVRWDRDNGI 45 L + IL SGDRRLARQRRT+E+ +GRDQM +W++NNVL+YK V +DK N V+W RDN + Sbjct: 247 LMDTILDSGDRRLARQRRTDEVVKGRDQMETWFQNNVLRYKTVVDTDKFNEVKWSRDNNV 306 Query: 44 F 42 F Sbjct: 307 F 307 >ref|XP_001797763.1| hypothetical protein SNOG_07430 [Phaeosphaeria nodorum SN15] gi|160701694|gb|EAT84896.2| hypothetical protein SNOG_07430 [Phaeosphaeria nodorum SN15] Length = 636 Score = 87.0 bits (214), Expect = 2e-15 Identities = 39/64 (60%), Positives = 49/64 (76%) Frame = -3 Query: 233 IPQLFENILASGDRRLARQRRTEELERGRDQMTSWYENNVLKYKVRVQSDKANAVRWDRD 54 I +LFE+I DRRL RQRR EELERGRDQM SW+ NNVL+++ V +DK + +RWDR+ Sbjct: 228 IERLFEDITEVSDRRLLRQRRGEELERGRDQMDSWFRNNVLRHRTTVDTDKVDKIRWDRE 287 Query: 53 NGIF 42 N IF Sbjct: 288 NSIF 291 >ref|XP_007580177.1| putative ankyrin repeat and btb poz domain protein [Neofusicoccum parvum UCRNP2] gi|485928683|gb|EOD52348.1| putative ankyrin repeat and btb poz domain protein [Neofusicoccum parvum UCRNP2] Length = 653 Score = 85.9 bits (211), Expect = 5e-15 Identities = 37/64 (57%), Positives = 53/64 (82%) Frame = -3 Query: 233 IPQLFENILASGDRRLARQRRTEELERGRDQMTSWYENNVLKYKVRVQSDKANAVRWDRD 54 I LF++IL + DRRLARQRRT+E+ RGRDQ+ W+ +NVLK++V + +DKA++V+WDR+ Sbjct: 236 IDHLFQHILENSDRRLARQRRTDEITRGRDQIEQWFRDNVLKHRVTLDTDKADSVKWDRN 295 Query: 53 NGIF 42 N IF Sbjct: 296 NRIF 299 >ref|XP_001257458.1| ankyrin repeat and BTB/POZ domain protein [Neosartorya fischeri NRRL 181] gi|119405610|gb|EAW15561.1| ankyrin repeat and BTB/POZ domain protein [Neosartorya fischeri NRRL 181] Length = 628 Score = 85.9 bits (211), Expect = 5e-15 Identities = 40/64 (62%), Positives = 47/64 (73%) Frame = -3 Query: 233 IPQLFENILASGDRRLARQRRTEELERGRDQMTSWYENNVLKYKVRVQSDKANAVRWDRD 54 IP L ++IL SGDRRLARQRR+ EL RGRDQ+ W+ NVL K+ V S K + VRWDR Sbjct: 243 IPSLLDSILDSGDRRLARQRRSMELSRGRDQLEEWFRKNVLGSKIEVDSSKVDEVRWDRH 302 Query: 53 NGIF 42 NGIF Sbjct: 303 NGIF 306 >ref|XP_747809.1| ankyrin repeat and BTB/POZ domain protein [Aspergillus fumigatus Af293] gi|66845436|gb|EAL85771.1| ankyrin repeat and BTB/POZ domain protein [Aspergillus fumigatus Af293] gi|159122591|gb|EDP47712.1| ankyrin repeat and BTB/POZ domain protein [Aspergillus fumigatus A1163] Length = 629 Score = 84.3 bits (207), Expect = 2e-14 Identities = 39/64 (60%), Positives = 46/64 (71%) Frame = -3 Query: 233 IPQLFENILASGDRRLARQRRTEELERGRDQMTSWYENNVLKYKVRVQSDKANAVRWDRD 54 IP L ++IL SGDRRLARQRR+ EL RGRDQ+ W+ NVL K+ V S K + RWDR Sbjct: 244 IPSLLDSILDSGDRRLARQRRSMELSRGRDQLEEWFRKNVLGSKIEVNSSKVDGFRWDRH 303 Query: 53 NGIF 42 NGIF Sbjct: 304 NGIF 307 >gb|EMF17914.1| ankyrin repeat and BTB/POZ domain-containing protein 1, partial [Sphaerulina musiva SO2202] Length = 659 Score = 84.3 bits (207), Expect = 2e-14 Identities = 35/64 (54%), Positives = 52/64 (81%) Frame = -3 Query: 233 IPQLFENILASGDRRLARQRRTEELERGRDQMTSWYENNVLKYKVRVQSDKANAVRWDRD 54 I QL++++L+SGDRR ARQRRTEE+ R RDQ+ +W+ +N+LK+K V ++K + V+WDR+ Sbjct: 238 IQQLYQDLLSSGDRRQARQRRTEEVSRSRDQLATWFSDNILKHKTTVATEKVDGVKWDRN 297 Query: 53 NGIF 42 N IF Sbjct: 298 NTIF 301 >gb|EUN30670.1| hypothetical protein COCVIDRAFT_89819 [Bipolaris victoriae FI3] Length = 646 Score = 83.2 bits (204), Expect = 4e-14 Identities = 37/64 (57%), Positives = 49/64 (76%) Frame = -3 Query: 233 IPQLFENILASGDRRLARQRRTEELERGRDQMTSWYENNVLKYKVRVQSDKANAVRWDRD 54 I +LFE+I DRRL RQRR +ELERGRDQ+ SW++ NVL++K V +DK +++RWDR Sbjct: 240 IERLFEDITEVSDRRLLRQRRADELERGRDQLESWFKTNVLRHKKVVDTDKVDSIRWDRQ 299 Query: 53 NGIF 42 N IF Sbjct: 300 NSIF 303