BLASTX nr result
ID: Akebia25_contig00066993
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00066993 (261 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003848625.1| hypothetical protein MYCGRDRAFT_111251 [Zymo... 70 3e-10 gb|EME40274.1| fungal Zn binuclear cluster domain-containing pro... 69 7e-10 gb|EMF09002.1| hypothetical protein SEPMUDRAFT_53003 [Sphaerulin... 68 1e-09 gb|EXJ89979.1| hypothetical protein A1O3_03046 [Capronia epimyce... 68 2e-09 gb|EXJ73433.1| hypothetical protein A1O5_03193 [Cladophialophora... 68 2e-09 gb|EXJ60087.1| hypothetical protein A1O7_04237 [Cladophialophora... 68 2e-09 gb|ETI25085.1| hypothetical protein G647_04456 [Cladophialophora... 68 2e-09 gb|EPS26599.1| hypothetical protein PDE_01536 [Penicillium oxali... 68 2e-09 gb|ETN41311.1| hypothetical protein HMPREF1541_03246 [Cyphelloph... 67 3e-09 gb|EXJ94674.1| hypothetical protein A1O1_03071 [Capronia coronat... 67 3e-09 gb|EMD00052.1| hypothetical protein BAUCODRAFT_51110, partial [B... 66 4e-09 gb|EUC49703.1| hypothetical protein COCMIDRAFT_83785 [Bipolaris ... 65 8e-09 gb|EUC39258.1| hypothetical protein COCCADRAFT_19 [Bipolaris zei... 65 8e-09 gb|EOA89699.1| hypothetical protein SETTUDRAFT_167519 [Setosphae... 65 8e-09 gb|EMD96814.1| hypothetical protein COCHEDRAFT_1150493 [Bipolari... 65 8e-09 gb|EMD68605.1| hypothetical protein COCSADRAFT_33488 [Bipolaris ... 65 8e-09 ref|XP_003841776.1| similar to C6 transcription factor (Fcr1) [L... 65 8e-09 ref|XP_003303937.1| hypothetical protein PTT_16339 [Pyrenophora ... 65 8e-09 ref|XP_001936724.1| conserved hypothetical protein [Pyrenophora ... 65 8e-09 ref|XP_001802319.1| hypothetical protein SNOG_12086 [Phaeosphaer... 65 8e-09 >ref|XP_003848625.1| hypothetical protein MYCGRDRAFT_111251 [Zymoseptoria tritici IPO323] gi|339468500|gb|EGP83601.1| hypothetical protein MYCGRDRAFT_111251 [Zymoseptoria tritici IPO323] Length = 366 Score = 70.1 bits (170), Expect = 3e-10 Identities = 38/66 (57%), Positives = 44/66 (66%), Gaps = 3/66 (4%) Frame = -1 Query: 189 TLSVITATMPPTS-SPAAKLXXXXXXXXXXXD--GIRKRVCKACDRCRLKKSKRDGSSPC 19 T+S + TM P++ SPA KL GIRKRVCKACDRCRLKKSK DGSSPC Sbjct: 12 TVSYHSHTMAPSAHSPATKLGHISRTASQDSTTDGIRKRVCKACDRCRLKKSKCDGSSPC 71 Query: 18 TRCKAD 1 +RC+ D Sbjct: 72 SRCRTD 77 >gb|EME40274.1| fungal Zn binuclear cluster domain-containing protein [Dothistroma septosporum NZE10] Length = 368 Score = 68.9 bits (167), Expect = 7e-10 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -1 Query: 96 GIRKRVCKACDRCRLKKSKRDGSSPCTRCKAD 1 GIRKRVCKACDRCRLKKSK DGSSPC+RCKAD Sbjct: 50 GIRKRVCKACDRCRLKKSKCDGSSPCSRCKAD 81 >gb|EMF09002.1| hypothetical protein SEPMUDRAFT_53003 [Sphaerulina musiva SO2202] Length = 345 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 96 GIRKRVCKACDRCRLKKSKRDGSSPCTRCKAD 1 GIRKRVCKACDRCRLKKSK DGS+PCTRCK+D Sbjct: 16 GIRKRVCKACDRCRLKKSKCDGSNPCTRCKSD 47 >gb|EXJ89979.1| hypothetical protein A1O3_03046 [Capronia epimyces CBS 606.96] Length = 296 Score = 67.8 bits (164), Expect = 2e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 96 GIRKRVCKACDRCRLKKSKRDGSSPCTRCKAD 1 GIRKRVCKACDRCRLKKSK DG+SPC+RCKAD Sbjct: 19 GIRKRVCKACDRCRLKKSKCDGASPCSRCKAD 50 >gb|EXJ73433.1| hypothetical protein A1O5_03193 [Cladophialophora psammophila CBS 110553] Length = 293 Score = 67.8 bits (164), Expect = 2e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 96 GIRKRVCKACDRCRLKKSKRDGSSPCTRCKAD 1 GIRKRVCKACDRCRLKKSK DG+SPC+RCKAD Sbjct: 19 GIRKRVCKACDRCRLKKSKCDGASPCSRCKAD 50 >gb|EXJ60087.1| hypothetical protein A1O7_04237 [Cladophialophora yegresii CBS 114405] Length = 289 Score = 67.8 bits (164), Expect = 2e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 96 GIRKRVCKACDRCRLKKSKRDGSSPCTRCKAD 1 GIRKRVCKACDRCRLKKSK DG+SPC+RCKAD Sbjct: 15 GIRKRVCKACDRCRLKKSKCDGASPCSRCKAD 46 >gb|ETI25085.1| hypothetical protein G647_04456 [Cladophialophora carrionii CBS 160.54] Length = 293 Score = 67.8 bits (164), Expect = 2e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 96 GIRKRVCKACDRCRLKKSKRDGSSPCTRCKAD 1 GIRKRVCKACDRCRLKKSK DG+SPC+RCKAD Sbjct: 19 GIRKRVCKACDRCRLKKSKCDGASPCSRCKAD 50 >gb|EPS26599.1| hypothetical protein PDE_01536 [Penicillium oxalicum 114-2] Length = 305 Score = 67.8 bits (164), Expect = 2e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 96 GIRKRVCKACDRCRLKKSKRDGSSPCTRCKAD 1 GIRKRVCKACDRCRLKKSK DGSSPC+RC+AD Sbjct: 18 GIRKRVCKACDRCRLKKSKCDGSSPCSRCRAD 49 >gb|ETN41311.1| hypothetical protein HMPREF1541_03246 [Cyphellophora europaea CBS 101466] Length = 288 Score = 67.0 bits (162), Expect = 3e-09 Identities = 33/55 (60%), Positives = 37/55 (67%) Frame = -1 Query: 165 MPPTSSPAAKLXXXXXXXXXXXDGIRKRVCKACDRCRLKKSKRDGSSPCTRCKAD 1 M P PA+ L GIRKRVCKACDRCRLKKSK DG++PC+RCKAD Sbjct: 2 MTPPMEPASPLDS----------GIRKRVCKACDRCRLKKSKCDGATPCSRCKAD 46 >gb|EXJ94674.1| hypothetical protein A1O1_03071 [Capronia coronata CBS 617.96] Length = 303 Score = 66.6 bits (161), Expect = 3e-09 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -1 Query: 96 GIRKRVCKACDRCRLKKSKRDGSSPCTRCKAD 1 GIRKRVCKACDRCRLKKSK DG++PC+RCKAD Sbjct: 14 GIRKRVCKACDRCRLKKSKCDGATPCSRCKAD 45 >gb|EMD00052.1| hypothetical protein BAUCODRAFT_51110, partial [Baudoinia compniacensis UAMH 10762] Length = 211 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -1 Query: 96 GIRKRVCKACDRCRLKKSKRDGSSPCTRCKAD 1 GIRKRVCKACDRCRLKKSK DGSSPC+RC+ D Sbjct: 10 GIRKRVCKACDRCRLKKSKCDGSSPCSRCRVD 41 >gb|EUC49703.1| hypothetical protein COCMIDRAFT_83785 [Bipolaris oryzae ATCC 44560] Length = 303 Score = 65.5 bits (158), Expect = 8e-09 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -1 Query: 93 IRKRVCKACDRCRLKKSKRDGSSPCTRCKAD 1 IRKRVCKACDRCRLKKSK DG+SPC+RCKAD Sbjct: 15 IRKRVCKACDRCRLKKSKCDGASPCSRCKAD 45 >gb|EUC39258.1| hypothetical protein COCCADRAFT_19 [Bipolaris zeicola 26-R-13] gi|578494769|gb|EUN32154.1| hypothetical protein COCVIDRAFT_85661 [Bipolaris victoriae FI3] Length = 303 Score = 65.5 bits (158), Expect = 8e-09 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -1 Query: 93 IRKRVCKACDRCRLKKSKRDGSSPCTRCKAD 1 IRKRVCKACDRCRLKKSK DG+SPC+RCKAD Sbjct: 15 IRKRVCKACDRCRLKKSKCDGASPCSRCKAD 45 >gb|EOA89699.1| hypothetical protein SETTUDRAFT_167519 [Setosphaeria turcica Et28A] Length = 303 Score = 65.5 bits (158), Expect = 8e-09 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -1 Query: 93 IRKRVCKACDRCRLKKSKRDGSSPCTRCKAD 1 IRKRVCKACDRCRLKKSK DG+SPC+RCKAD Sbjct: 15 IRKRVCKACDRCRLKKSKCDGASPCSRCKAD 45 >gb|EMD96814.1| hypothetical protein COCHEDRAFT_1150493 [Bipolaris maydis C5] gi|477586597|gb|ENI03681.1| hypothetical protein COCC4DRAFT_82367 [Bipolaris maydis ATCC 48331] Length = 303 Score = 65.5 bits (158), Expect = 8e-09 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -1 Query: 93 IRKRVCKACDRCRLKKSKRDGSSPCTRCKAD 1 IRKRVCKACDRCRLKKSK DG+SPC+RCKAD Sbjct: 15 IRKRVCKACDRCRLKKSKCDGASPCSRCKAD 45 >gb|EMD68605.1| hypothetical protein COCSADRAFT_33488 [Bipolaris sorokiniana ND90Pr] Length = 303 Score = 65.5 bits (158), Expect = 8e-09 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -1 Query: 93 IRKRVCKACDRCRLKKSKRDGSSPCTRCKAD 1 IRKRVCKACDRCRLKKSK DG+SPC+RCKAD Sbjct: 15 IRKRVCKACDRCRLKKSKCDGASPCSRCKAD 45 >ref|XP_003841776.1| similar to C6 transcription factor (Fcr1) [Leptosphaeria maculans JN3] gi|312218351|emb|CBX98297.1| similar to C6 transcription factor (Fcr1) [Leptosphaeria maculans JN3] Length = 305 Score = 65.5 bits (158), Expect = 8e-09 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -1 Query: 93 IRKRVCKACDRCRLKKSKRDGSSPCTRCKAD 1 IRKRVCKACDRCRLKKSK DG+SPC+RCKAD Sbjct: 15 IRKRVCKACDRCRLKKSKCDGASPCSRCKAD 45 >ref|XP_003303937.1| hypothetical protein PTT_16339 [Pyrenophora teres f. teres 0-1] gi|311319737|gb|EFQ87956.1| hypothetical protein PTT_16339 [Pyrenophora teres f. teres 0-1] Length = 304 Score = 65.5 bits (158), Expect = 8e-09 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -1 Query: 93 IRKRVCKACDRCRLKKSKRDGSSPCTRCKAD 1 IRKRVCKACDRCRLKKSK DG+SPC+RCKAD Sbjct: 15 IRKRVCKACDRCRLKKSKCDGASPCSRCKAD 45 >ref|XP_001936724.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187983823|gb|EDU49311.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 304 Score = 65.5 bits (158), Expect = 8e-09 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -1 Query: 93 IRKRVCKACDRCRLKKSKRDGSSPCTRCKAD 1 IRKRVCKACDRCRLKKSK DG+SPC+RCKAD Sbjct: 15 IRKRVCKACDRCRLKKSKCDGASPCSRCKAD 45 >ref|XP_001802319.1| hypothetical protein SNOG_12086 [Phaeosphaeria nodorum SN15] gi|111059378|gb|EAT80498.1| hypothetical protein SNOG_12086 [Phaeosphaeria nodorum SN15] Length = 301 Score = 65.5 bits (158), Expect = 8e-09 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -1 Query: 93 IRKRVCKACDRCRLKKSKRDGSSPCTRCKAD 1 IRKRVCKACDRCRLKKSK DG+SPC+RCKAD Sbjct: 15 IRKRVCKACDRCRLKKSKCDGASPCSRCKAD 45