BLASTX nr result
ID: Akebia25_contig00066956
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00066956 (293 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMF10873.1| hypothetical protein SEPMUDRAFT_150831 [Sphaeruli... 62 1e-07 gb|EME43911.1| hypothetical protein DOTSEDRAFT_71649 [Dothistrom... 62 1e-07 gb|EME79069.1| hypothetical protein MYCFIDRAFT_51028 [Pseudocerc... 60 2e-07 gb|EMC95403.1| hypothetical protein BAUCODRAFT_73015 [Baudoinia ... 57 2e-06 ref|XP_007586939.1| hypothetical protein UCRNP2_7691 [Neofusicoc... 56 6e-06 >gb|EMF10873.1| hypothetical protein SEPMUDRAFT_150831 [Sphaerulina musiva SO2202] Length = 483 Score = 61.6 bits (148), Expect = 1e-07 Identities = 25/51 (49%), Positives = 38/51 (74%), Gaps = 2/51 (3%) Frame = +1 Query: 1 SEGAWPRYSHNSTKGPYGSSGTYGKGDE--SWDAVMEEEFMHGISRRWITL 147 S GA+PR STKGPYG++G YGK ++ +WDA+ E+E++HG+ + W+ L Sbjct: 433 SAGAFPRGKQVSTKGPYGTTGVYGKENDGVNWDAIWEDEYLHGVEQGWVQL 483 >gb|EME43911.1| hypothetical protein DOTSEDRAFT_71649 [Dothistroma septosporum NZE10] Length = 484 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/52 (50%), Positives = 34/52 (65%), Gaps = 3/52 (5%) Frame = +1 Query: 1 SEGAWPRYSHNSTKGPYGSSGTYGKG---DESWDAVMEEEFMHGISRRWITL 147 S G WPR + STKGPYG++G YG G D SWDAV E+E++ + W+ L Sbjct: 433 SHGQWPRRTEVSTKGPYGTTGVYGDGKGDDSSWDAVWEDEYLRAVEMGWVQL 484 >gb|EME79069.1| hypothetical protein MYCFIDRAFT_51028 [Pseudocercospora fijiensis CIRAD86] Length = 483 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/51 (50%), Positives = 35/51 (68%), Gaps = 2/51 (3%) Frame = +1 Query: 1 SEGAWPRYSHNSTKGPYGSSGTYGKGDE--SWDAVMEEEFMHGISRRWITL 147 S G WPR STKGPYG++G YGK ++ +WDAV EEE++ + R W+ L Sbjct: 433 SRGQWPRGKVVSTKGPYGTTGVYGKEEDGVNWDAVDEEEYLRAVERGWVVL 483 >gb|EMC95403.1| hypothetical protein BAUCODRAFT_73015 [Baudoinia compniacensis UAMH 10762] Length = 483 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/49 (48%), Positives = 30/49 (61%) Frame = +1 Query: 1 SEGAWPRYSHNSTKGPYGSSGTYGKGDESWDAVMEEEFMHGISRRWITL 147 S G WP ST GPYG SG YGK + WDAV EE+++ ++ WI L Sbjct: 435 SRGRWPFDKQPSTLGPYGQSGRYGKDEGFWDAVSEEDYLLAVTNHWIAL 483 >ref|XP_007586939.1| hypothetical protein UCRNP2_7691 [Neofusicoccum parvum UCRNP2] gi|485919160|gb|EOD45580.1| hypothetical protein UCRNP2_7691 [Neofusicoccum parvum UCRNP2] Length = 430 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/50 (54%), Positives = 33/50 (66%), Gaps = 1/50 (2%) Frame = +1 Query: 1 SEGAWPRYSHNSTKGPYGSSGTYGKGDES-WDAVMEEEFMHGISRRWITL 147 SEG WPR S KGPYGS+G YGK +E + V E EF+ G+SRR + L Sbjct: 379 SEGQWPRSHQPSRKGPYGSTGLYGKDEEDVFSMVNEAEFLEGVSRRCVYL 428