BLASTX nr result
ID: Akebia25_contig00066857
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00066857 (282 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EON68855.1| hypothetical protein W97_08113 [Coniosporium apol... 79 5e-13 gb|EKG21325.1| Major sperm protein [Macrophomina phaseolina MS6] 60 3e-07 ref|XP_007580871.1| putative msp domain containing protein [Neof... 60 4e-07 >gb|EON68855.1| hypothetical protein W97_08113 [Coniosporium apollinis CBS 100218] Length = 281 Score = 79.3 bits (194), Expect = 5e-13 Identities = 39/55 (70%), Positives = 44/55 (80%) Frame = -2 Query: 278 VLRQRKTDSVNQDSKERIXXXXXXXGVQQTPASGVPVQVVAGLCLLCFLIAYFFF 114 VLRQRK+D++NQD+KERI G QQ ASGVPVQVVAGLCLLCFL+AYF F Sbjct: 227 VLRQRKSDAINQDTKERITTGSTGMGTQQVAASGVPVQVVAGLCLLCFLLAYFLF 281 >gb|EKG21325.1| Major sperm protein [Macrophomina phaseolina MS6] Length = 285 Score = 60.1 bits (144), Expect = 3e-07 Identities = 31/54 (57%), Positives = 36/54 (66%) Frame = -2 Query: 275 LRQRKTDSVNQDSKERIXXXXXXXGVQQTPASGVPVQVVAGLCLLCFLIAYFFF 114 LRQRK +S + +SK VQQ PA GVPVQ+VAGLCL FL+AYFFF Sbjct: 236 LRQRKGESASSNSKSETSNLA----VQQAPAGGVPVQIVAGLCLFSFLLAYFFF 285 >ref|XP_007580871.1| putative msp domain containing protein [Neofusicoccum parvum UCRNP2] gi|485927710|gb|EOD51637.1| putative msp domain containing protein [Neofusicoccum parvum UCRNP2] Length = 290 Score = 59.7 bits (143), Expect = 4e-07 Identities = 31/54 (57%), Positives = 35/54 (64%) Frame = -2 Query: 275 LRQRKTDSVNQDSKERIXXXXXXXGVQQTPASGVPVQVVAGLCLLCFLIAYFFF 114 LRQRK + VN K + VQQ PA GVPVQ+VAGLCL FL+AYFFF Sbjct: 241 LRQRKGEGVNSKDKAQTSSLA----VQQAPAGGVPVQIVAGLCLFSFLLAYFFF 290