BLASTX nr result
ID: Akebia25_contig00066694
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00066694 (298 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMC95352.1| hypothetical protein BAUCODRAFT_35336 [Baudoinia ... 56 6e-06 >gb|EMC95352.1| hypothetical protein BAUCODRAFT_35336 [Baudoinia compniacensis UAMH 10762] Length = 281 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/42 (54%), Positives = 30/42 (71%) Frame = -1 Query: 292 YWICSAIVGNPDGLDGRNDGRELVLGTRRRWLGWLMMGVVEE 167 YW+ S +VG+P G+D ++DGRE VLG RR W WL+ V EE Sbjct: 240 YWVSSLVVGDPAGMDKQDDGRETVLGLRRWWEAWLLRSVKEE 281