BLASTX nr result
ID: Akebia25_contig00066480
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00066480 (346 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006695993.1| putative copper transport protein [Chaetomiu... 56 4e-06 >ref|XP_006695993.1| putative copper transport protein [Chaetomium thermophilum var. thermophilum DSM 1495] gi|340924145|gb|EGS19048.1| putative copper transport protein [Chaetomium thermophilum var. thermophilum DSM 1495] Length = 162 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/46 (52%), Positives = 26/46 (56%) Frame = +2 Query: 209 PKCNMNMLFTWNTENLCIVFESWRXXXXXXXXXXXXXXXXXCAGYE 346 P CNMNMLFTW+T+NLCIVF WR CAGYE Sbjct: 28 PMCNMNMLFTWSTDNLCIVFRQWRITSTPSLLVSLALIVTICAGYE 73