BLASTX nr result
ID: Akebia25_contig00066462
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00066462 (241 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006857604.1| hypothetical protein AMTR_s00061p00104430 [A... 66 4e-09 ref|XP_002524561.1| conserved hypothetical protein [Ricinus comm... 56 5e-06 >ref|XP_006857604.1| hypothetical protein AMTR_s00061p00104430 [Amborella trichopoda] gi|548861700|gb|ERN19071.1| hypothetical protein AMTR_s00061p00104430 [Amborella trichopoda] Length = 1194 Score = 66.2 bits (160), Expect = 4e-09 Identities = 39/91 (42%), Positives = 48/91 (52%), Gaps = 14/91 (15%) Frame = +3 Query: 6 LSDLGTPSAPPIVEIGREETKFGDVEIEQTS--------------NEMHSSSETRTGIGS 143 LS+ G PSAPP+V+ F E+E T+ NE+H+ ET S Sbjct: 206 LSEAGNPSAPPMVDSRTGSQSF---EMEATTLPGARVISETKNVYNELHAQDETNLSCDS 262 Query: 144 KEVLTDWGAQSHKSNEPCVRTISDETEPQIP 236 KE LTD GAQSH +NEPC R I E E Q+P Sbjct: 263 KECLTDLGAQSHAANEPCPRYIPGEVETQMP 293 >ref|XP_002524561.1| conserved hypothetical protein [Ricinus communis] gi|223536114|gb|EEF37769.1| conserved hypothetical protein [Ricinus communis] Length = 1091 Score = 56.2 bits (134), Expect = 5e-06 Identities = 36/83 (43%), Positives = 49/83 (59%), Gaps = 4/83 (4%) Frame = +3 Query: 3 KLSDLGTPSAPPIVEIGREETKF-GDVEIEQTSNEMHSSSETRTGIGSKEVLTDWGAQSH 179 ++ DLGTPSAPPI E EE KF + EIEQ + +S ET GSKE L D +QS Sbjct: 113 EIRDLGTPSAPPIAETRGEEKKFLVEHEIEQIGTGVSNSGETEIFDGSKEGLLDRTSQSM 172 Query: 180 KSNEPCVR---TISDETEPQIPY 239 +NE R +++E + ++PY Sbjct: 173 PTNEFVERLNNNMAEEADEKMPY 195