BLASTX nr result
ID: Akebia25_contig00066329
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00066329 (263 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMF09785.1| hypothetical protein SEPMUDRAFT_135230 [Sphaeruli... 63 4e-08 ref|XP_003850765.1| hypothetical protein MYCGRDRAFT_105265 [Zymo... 60 3e-07 gb|EME39321.1| hypothetical protein DOTSEDRAFT_83110 [Dothistrom... 57 2e-06 >gb|EMF09785.1| hypothetical protein SEPMUDRAFT_135230 [Sphaerulina musiva SO2202] Length = 205 Score = 63.2 bits (152), Expect = 4e-08 Identities = 25/36 (69%), Positives = 28/36 (77%) Frame = +1 Query: 1 LPFFICQQWKINCVNSHPNDATGQANCHSLVCGSKN 108 LPFFIC+QWK NCV SHP+D GQA C S+ CGS N Sbjct: 90 LPFFICEQWKTNCVASHPDDLDGQAGCQSVTCGSMN 125 >ref|XP_003850765.1| hypothetical protein MYCGRDRAFT_105265 [Zymoseptoria tritici IPO323] gi|339470644|gb|EGP85741.1| hypothetical protein MYCGRDRAFT_105265 [Zymoseptoria tritici IPO323] Length = 199 Score = 60.1 bits (144), Expect = 3e-07 Identities = 24/36 (66%), Positives = 29/36 (80%) Frame = +1 Query: 1 LPFFICQQWKINCVNSHPNDATGQANCHSLVCGSKN 108 +PF+ICQQW NCV S+PNDAT Q C S+VCGS+N Sbjct: 89 VPFYICQQWIANCVASNPNDATAQFGCRSVVCGSQN 124 >gb|EME39321.1| hypothetical protein DOTSEDRAFT_83110 [Dothistroma septosporum NZE10] Length = 199 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/36 (63%), Positives = 26/36 (72%) Frame = +1 Query: 1 LPFFICQQWKINCVNSHPNDATGQANCHSLVCGSKN 108 +P FIC QWK NCV +HPND GQ C S+VCGS N Sbjct: 90 IPSFICAQWKSNCVANHPNDLDGQTGCLSVVCGSAN 125