BLASTX nr result
ID: Akebia25_contig00066120
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00066120 (266 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003849496.1| hypothetical protein MYCGRDRAFT_95893 [Zymos... 57 2e-06 gb|EME40652.1| hypothetical protein DOTSEDRAFT_27279 [Dothistrom... 56 6e-06 >ref|XP_003849496.1| hypothetical protein MYCGRDRAFT_95893 [Zymoseptoria tritici IPO323] gi|339469373|gb|EGP84472.1| hypothetical protein MYCGRDRAFT_95893 [Zymoseptoria tritici IPO323] Length = 830 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/39 (58%), Positives = 32/39 (82%) Frame = -3 Query: 120 FDKLDAALELAQSACEKAAHQILREGDCKPEAEKAKNQF 4 FD++D LE AQ++CE+AAHQ+LREGDC PE +A++ F Sbjct: 207 FDQVDGRLEKAQASCERAAHQVLREGDCTPEVSQARDHF 245 >gb|EME40652.1| hypothetical protein DOTSEDRAFT_27279 [Dothistroma septosporum NZE10] Length = 371 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/46 (56%), Positives = 32/46 (69%) Frame = -3 Query: 141 RDDAAAVFDKLDAALELAQSACEKAAHQILREGDCKPEAEKAKNQF 4 R+ VFDK+DA LE AQ+ CE+AAHQILR+GDC E A+ F Sbjct: 210 RNADTEVFDKVDAKLERAQALCERAAHQILRDGDCTLEVTNARENF 255