BLASTX nr result
ID: Akebia25_contig00066056
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00066056 (272 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516625.1| conserved hypothetical protein [Ricinus comm... 59 1e-11 >ref|XP_002516625.1| conserved hypothetical protein [Ricinus communis] gi|223544227|gb|EEF45749.1| conserved hypothetical protein [Ricinus communis] Length = 166 Score = 58.5 bits (140), Expect(2) = 1e-11 Identities = 34/70 (48%), Positives = 34/70 (48%) Frame = -3 Query: 270 PLKTVRAGLPACGSRHSRWPSPAFIRKSCSEIETARPRKLIRV*AALSVVPLTLSIH*SI 91 PLKTV AGLP CGS HSRW SPAFI KSCS Sbjct: 50 PLKTVCAGLPTCGSCHSRWSSPAFIHKSCS------------------------------ 79 Query: 90 GSLPLFPRIH 61 SLPLFPRIH Sbjct: 80 -SLPLFPRIH 88 Score = 36.2 bits (82), Expect(2) = 1e-11 Identities = 18/26 (69%), Positives = 20/26 (76%) Frame = -1 Query: 80 LFFQEFMSRSEKAFHFRQMTRPPLAL 3 L + F +R KAFHFRQMTRPPLAL Sbjct: 92 LLHRAFYNRG-KAFHFRQMTRPPLAL 116