BLASTX nr result
ID: Akebia25_contig00065311
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00065311 (293 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME89380.1| hypothetical protein MYCFIDRAFT_61565 [Pseudocerc... 93 3e-17 gb|ERT01919.1| ribosomal protein L33 [Sporothrix schenckii ATCC ... 93 4e-17 gb|EMF17802.1| ribosomal protein L33-containing protein [Sphaeru... 92 8e-17 gb|EME50358.1| hypothetical protein DOTSEDRAFT_59454 [Dothistrom... 92 1e-16 ref|XP_002847181.1| mitochondrial 54S ribosomal protein YmL39 [A... 92 1e-16 gb|EEH05706.1| conserved hypothetical protein [Ajellomyces capsu... 92 1e-16 gb|EZF20243.1| ribosomal protein L33 [Trichophyton rubrum MR850]... 91 1e-16 ref|XP_003650392.1| mitochondrial 54S ribosomal protein YmL39 [T... 91 2e-16 ref|XP_002627478.1| mitochondrial 54S ribosomal protein YmL39 [A... 91 2e-16 ref|XP_002541632.1| predicted protein [Uncinocarpus reesii 1704]... 90 3e-16 ref|XP_003664058.1| hypothetical protein MYCTH_2119125 [Myceliop... 90 4e-16 ref|XP_006694795.1| hypothetical protein CTHT_0044030 [Chaetomiu... 90 4e-16 gb|ESA42249.1| hypothetical protein NCU17114 [Neurospora crassa ... 89 5e-16 gb|EMC99645.1| hypothetical protein BAUCODRAFT_145039 [Baudoinia... 89 5e-16 gb|EHY59948.1| 50S ribosomal protein L33 [Exophiala dermatitidis... 89 5e-16 emb|CCC13001.1| unnamed protein product [Sordaria macrospora k-h... 89 6e-16 gb|EEH19491.1| predicted protein [Paracoccidioides brasiliensis ... 89 6e-16 emb|CCU82631.1| ribosomal protein L33 [Blumeria graminis f. sp. ... 89 8e-16 ref|XP_002839169.1| hypothetical protein [Tuber melanosporum Mel... 89 8e-16 gb|ETI19585.1| ribosomal protein L33, partial [Cladophialophora ... 88 1e-15 >gb|EME89380.1| hypothetical protein MYCFIDRAFT_61565 [Pseudocercospora fijiensis CIRAD86] Length = 58 Score = 93.2 bits (230), Expect = 3e-17 Identities = 45/58 (77%), Positives = 51/58 (87%) Frame = -2 Query: 277 MAKKQKSRIIAVRLLSMAMTGYFKTYTRPRTARPLSFLRYDPIVKQKVLFLEQKRSKK 104 MAKK KSR IAVRL+SMAMTGY+KT+TRPRT RPLS L+YDP+VK+KVLFLE KR K Sbjct: 1 MAKKAKSRTIAVRLISMAMTGYYKTFTRPRTHRPLSMLKYDPVVKKKVLFLEAKRGGK 58 >gb|ERT01919.1| ribosomal protein L33 [Sporothrix schenckii ATCC 58251] Length = 58 Score = 92.8 bits (229), Expect = 4e-17 Identities = 44/58 (75%), Positives = 54/58 (93%) Frame = -2 Query: 277 MAKKQKSRIIAVRLLSMAMTGYFKTYTRPRTARPLSFLRYDPIVKQKVLFLEQKRSKK 104 MAKK KSR+I+VR+LSMAMTG+F T+TRPRT+ PLSFL+YDPIV++KVLFLE+KRS K Sbjct: 1 MAKKAKSRVISVRVLSMAMTGFFYTFTRPRTSTPLSFLKYDPIVRRKVLFLEKKRSGK 58 >gb|EMF17802.1| ribosomal protein L33-containing protein [Sphaerulina musiva SO2202] Length = 58 Score = 92.0 bits (227), Expect = 8e-17 Identities = 44/58 (75%), Positives = 51/58 (87%) Frame = -2 Query: 277 MAKKQKSRIIAVRLLSMAMTGYFKTYTRPRTARPLSFLRYDPIVKQKVLFLEQKRSKK 104 MAKK KSR +AVRL+SMAMTGY+KT+TRPRT RPLS L+YDP+VK+KVLFLE KR K Sbjct: 1 MAKKAKSRNVAVRLISMAMTGYYKTFTRPRTHRPLSMLKYDPVVKKKVLFLEAKRGGK 58 >gb|EME50358.1| hypothetical protein DOTSEDRAFT_59454 [Dothistroma septosporum NZE10] Length = 58 Score = 91.7 bits (226), Expect = 1e-16 Identities = 44/58 (75%), Positives = 51/58 (87%) Frame = -2 Query: 277 MAKKQKSRIIAVRLLSMAMTGYFKTYTRPRTARPLSFLRYDPIVKQKVLFLEQKRSKK 104 MAKK KSR IAVRL+SMAMTGY+KT++RPRT RPLS L+YDP+VK+KVLFLE KR K Sbjct: 1 MAKKAKSRTIAVRLISMAMTGYYKTFSRPRTHRPLSMLKYDPVVKKKVLFLEAKRGGK 58 >ref|XP_002847181.1| mitochondrial 54S ribosomal protein YmL39 [Arthroderma otae CBS 113480] gi|238842437|gb|EEQ32099.1| conserved hypothetical protein [Arthroderma otae CBS 113480] Length = 57 Score = 91.7 bits (226), Expect = 1e-16 Identities = 43/57 (75%), Positives = 51/57 (89%) Frame = -2 Query: 277 MAKKQKSRIIAVRLLSMAMTGYFKTYTRPRTARPLSFLRYDPIVKQKVLFLEQKRSK 107 MAKK KSR IAVRL+SMAMTGY+KT+TRPR +RPLS L+YDP+VK++VLFLE KR K Sbjct: 1 MAKKAKSRTIAVRLISMAMTGYYKTFTRPRASRPLSMLKYDPVVKKQVLFLESKRRK 57 >gb|EEH05706.1| conserved hypothetical protein [Ajellomyces capsulatus G186AR] gi|240278056|gb|EER41563.1| conserved hypothetical protein [Ajellomyces capsulatus H143] gi|325096120|gb|EGC49430.1| conserved hypothetical protein [Ajellomyces capsulatus H88] Length = 57 Score = 91.7 bits (226), Expect = 1e-16 Identities = 44/57 (77%), Positives = 50/57 (87%) Frame = -2 Query: 277 MAKKQKSRIIAVRLLSMAMTGYFKTYTRPRTARPLSFLRYDPIVKQKVLFLEQKRSK 107 MAKK KSR IAVRL+SMAMTGY+KT RPRT+RPLS L+YDP+VK+KVLFLE KR K Sbjct: 1 MAKKAKSRTIAVRLISMAMTGYYKTLVRPRTSRPLSMLKYDPVVKKKVLFLEAKRGK 57 >gb|EZF20243.1| ribosomal protein L33 [Trichophyton rubrum MR850] gi|607903312|gb|EZF40807.1| ribosomal protein L33 [Trichophyton rubrum CBS 100081] gi|607915390|gb|EZF51424.1| ribosomal protein L33 [Trichophyton rubrum CBS 288.86] gi|607927411|gb|EZF62007.1| ribosomal protein L33 [Trichophyton rubrum CBS 289.86] gi|607939412|gb|EZF72698.1| ribosomal protein L33 [Trichophyton soudanense CBS 452.61] gi|607951550|gb|EZF83478.1| ribosomal protein L33 [Trichophyton rubrum MR1448] gi|607963580|gb|EZF94049.1| ribosomal protein L33 [Trichophyton rubrum MR1459] gi|607976197|gb|EZG05408.1| ribosomal protein L33 [Trichophyton rubrum CBS 735.88] gi|607987680|gb|EZG15707.1| ribosomal protein L33 [Trichophyton rubrum CBS 202.88] Length = 57 Score = 91.3 bits (225), Expect = 1e-16 Identities = 43/57 (75%), Positives = 51/57 (89%) Frame = -2 Query: 277 MAKKQKSRIIAVRLLSMAMTGYFKTYTRPRTARPLSFLRYDPIVKQKVLFLEQKRSK 107 MAKK KSR IAVRL+SMAMTGY+KT+TRPR +RPLS L+YDP+VK++VLFLE KR K Sbjct: 1 MAKKAKSRTIAVRLISMAMTGYYKTFTRPRASRPLSMLKYDPVVKKQVLFLEAKRRK 57 >ref|XP_003650392.1| mitochondrial 54S ribosomal protein YmL39 [Thielavia terrestris NRRL 8126] gi|346997653|gb|AEO64056.1| hypothetical protein THITE_2169592 [Thielavia terrestris NRRL 8126] Length = 58 Score = 90.5 bits (223), Expect = 2e-16 Identities = 43/58 (74%), Positives = 52/58 (89%) Frame = -2 Query: 277 MAKKQKSRIIAVRLLSMAMTGYFKTYTRPRTARPLSFLRYDPIVKQKVLFLEQKRSKK 104 MAKK KSRII+VRLLSMAMTGYF T+TRPRT+ P+S ++YDPIV+++VLFLEQKR K Sbjct: 1 MAKKAKSRIISVRLLSMAMTGYFYTFTRPRTSLPMSMIKYDPIVRRRVLFLEQKRKGK 58 >ref|XP_002627478.1| mitochondrial 54S ribosomal protein YmL39 [Ajellomyces dermatitidis SLH14081] gi|239592537|gb|EEQ75118.1| 50S ribosomal protein L33 [Ajellomyces dermatitidis SLH14081] gi|239611310|gb|EEQ88297.1| 50S ribosomal protein L33 [Ajellomyces dermatitidis ER-3] gi|327348682|gb|EGE77539.1| 50S ribosomal protein L33 [Ajellomyces dermatitidis ATCC 18188] Length = 57 Score = 90.5 bits (223), Expect = 2e-16 Identities = 43/57 (75%), Positives = 50/57 (87%) Frame = -2 Query: 277 MAKKQKSRIIAVRLLSMAMTGYFKTYTRPRTARPLSFLRYDPIVKQKVLFLEQKRSK 107 MAKK KSR IAVRL+SMAMTGY++T RPRT+RPLS L+YDP+VK+KVLFLE KR K Sbjct: 1 MAKKAKSRTIAVRLISMAMTGYYRTLVRPRTSRPLSMLKYDPVVKKKVLFLEAKRGK 57 >ref|XP_002541632.1| predicted protein [Uncinocarpus reesii 1704] gi|237901898|gb|EEP76299.1| predicted protein [Uncinocarpus reesii 1704] Length = 57 Score = 90.1 bits (222), Expect = 3e-16 Identities = 44/57 (77%), Positives = 49/57 (85%) Frame = -2 Query: 277 MAKKQKSRIIAVRLLSMAMTGYFKTYTRPRTARPLSFLRYDPIVKQKVLFLEQKRSK 107 MAKK KSR IAVRLLSMAMTGY+KT RPR +RPLS L+YDP+VK+KVLFLE KR K Sbjct: 1 MAKKAKSRTIAVRLLSMAMTGYYKTLVRPRASRPLSMLKYDPVVKKKVLFLEVKRGK 57 >ref|XP_003664058.1| hypothetical protein MYCTH_2119125 [Myceliophthora thermophila ATCC 42464] gi|347011328|gb|AEO58813.1| hypothetical protein MYCTH_2119125 [Myceliophthora thermophila ATCC 42464] Length = 58 Score = 89.7 bits (221), Expect = 4e-16 Identities = 43/58 (74%), Positives = 51/58 (87%) Frame = -2 Query: 277 MAKKQKSRIIAVRLLSMAMTGYFKTYTRPRTARPLSFLRYDPIVKQKVLFLEQKRSKK 104 MAKK KSRII VRL+SMAMTGYF T+TRPRTA P+S ++YDPIV+++VLFLEQKR K Sbjct: 1 MAKKAKSRIINVRLISMAMTGYFYTFTRPRTALPMSMIKYDPIVRRRVLFLEQKRKGK 58 >ref|XP_006694795.1| hypothetical protein CTHT_0044030 [Chaetomium thermophilum var. thermophilum DSM 1495] gi|340939288|gb|EGS19910.1| hypothetical protein CTHT_0044030 [Chaetomium thermophilum var. thermophilum DSM 1495] Length = 119 Score = 89.7 bits (221), Expect = 4e-16 Identities = 42/58 (72%), Positives = 52/58 (89%) Frame = -2 Query: 277 MAKKQKSRIIAVRLLSMAMTGYFKTYTRPRTARPLSFLRYDPIVKQKVLFLEQKRSKK 104 MAKK KSR+I+VRL+SMAMTGYF T+TRPRT+ PLS ++YDPIV+++VLFLEQKR K Sbjct: 62 MAKKAKSRVISVRLVSMAMTGYFYTFTRPRTSLPLSMIKYDPIVRRRVLFLEQKRKGK 119 >gb|ESA42249.1| hypothetical protein NCU17114 [Neurospora crassa OR74A] Length = 59 Score = 89.4 bits (220), Expect = 5e-16 Identities = 43/55 (78%), Positives = 50/55 (90%) Frame = -2 Query: 277 MAKKQKSRIIAVRLLSMAMTGYFKTYTRPRTARPLSFLRYDPIVKQKVLFLEQKR 113 MAKK KSRII VRL+SMAMTGYF T+TRPRT+ P+S L+YDPIV++KVLFLEQKR Sbjct: 1 MAKKAKSRIINVRLISMAMTGYFYTFTRPRTSLPMSMLKYDPIVRRKVLFLEQKR 55 >gb|EMC99645.1| hypothetical protein BAUCODRAFT_145039 [Baudoinia compniacensis UAMH 10762] Length = 59 Score = 89.4 bits (220), Expect = 5e-16 Identities = 43/55 (78%), Positives = 49/55 (89%) Frame = -2 Query: 277 MAKKQKSRIIAVRLLSMAMTGYFKTYTRPRTARPLSFLRYDPIVKQKVLFLEQKR 113 MAKK KSR I+VRLLSMAMTGY+ T+TRPR RPLS L+YDP+VK+KVLFLEQKR Sbjct: 1 MAKKAKSRTISVRLLSMAMTGYYMTFTRPRQHRPLSMLKYDPVVKKKVLFLEQKR 55 >gb|EHY59948.1| 50S ribosomal protein L33 [Exophiala dermatitidis NIH/UT8656] Length = 57 Score = 89.4 bits (220), Expect = 5e-16 Identities = 42/57 (73%), Positives = 50/57 (87%) Frame = -2 Query: 277 MAKKQKSRIIAVRLLSMAMTGYFKTYTRPRTARPLSFLRYDPIVKQKVLFLEQKRSK 107 MAKK KSR IAVRL+SMAMTGY++T RPR +RPLS L+YDP+VK++VLFLEQKR K Sbjct: 1 MAKKAKSRTIAVRLISMAMTGYYRTLVRPRASRPLSMLKYDPVVKRQVLFLEQKRGK 57 >emb|CCC13001.1| unnamed protein product [Sordaria macrospora k-hell] Length = 58 Score = 89.0 bits (219), Expect = 6e-16 Identities = 43/55 (78%), Positives = 50/55 (90%) Frame = -2 Query: 277 MAKKQKSRIIAVRLLSMAMTGYFKTYTRPRTARPLSFLRYDPIVKQKVLFLEQKR 113 MAKK KSRII VRL+SMAMTGYF T+TRPRT+ P+S L+YDPIV++KVLFLEQKR Sbjct: 1 MAKKVKSRIINVRLISMAMTGYFYTFTRPRTSLPMSMLKYDPIVRRKVLFLEQKR 55 >gb|EEH19491.1| predicted protein [Paracoccidioides brasiliensis Pb03] Length = 72 Score = 89.0 bits (219), Expect = 6e-16 Identities = 42/56 (75%), Positives = 50/56 (89%) Frame = -2 Query: 277 MAKKQKSRIIAVRLLSMAMTGYFKTYTRPRTARPLSFLRYDPIVKQKVLFLEQKRS 110 MAK+ KSR IAVRL+SMAMTGY+KT RPRT+RPLS L+YDP+VK+KVLFLE KR+ Sbjct: 1 MAKRAKSRTIAVRLISMAMTGYYKTLVRPRTSRPLSMLKYDPVVKKKVLFLEAKRA 56 >emb|CCU82631.1| ribosomal protein L33 [Blumeria graminis f. sp. hordei DH14] Length = 59 Score = 88.6 bits (218), Expect = 8e-16 Identities = 42/55 (76%), Positives = 49/55 (89%) Frame = -2 Query: 277 MAKKQKSRIIAVRLLSMAMTGYFKTYTRPRTARPLSFLRYDPIVKQKVLFLEQKR 113 MAKK KSR IAVRL+SMA+TGY+KT RPRT RPLS L+YDP+V++KVLFLEQKR Sbjct: 1 MAKKPKSRTIAVRLISMALTGYYKTMVRPRTHRPLSMLKYDPVVRKKVLFLEQKR 55 >ref|XP_002839169.1| hypothetical protein [Tuber melanosporum Mel28] gi|295635175|emb|CAZ83360.1| unnamed protein product [Tuber melanosporum] Length = 149 Score = 88.6 bits (218), Expect = 8e-16 Identities = 41/57 (71%), Positives = 50/57 (87%) Frame = -2 Query: 277 MAKKQKSRIIAVRLLSMAMTGYFKTYTRPRTARPLSFLRYDPIVKQKVLFLEQKRSK 107 MAKK KSR I VRL+SMAMTGYFK++ RPRT +PLS ++YDP+VK++VLFLEQKR K Sbjct: 91 MAKKAKSRNIVVRLISMAMTGYFKSFVRPRTHKPLSMIKYDPVVKRRVLFLEQKRGK 147 >gb|ETI19585.1| ribosomal protein L33, partial [Cladophialophora carrionii CBS 160.54] gi|589970766|gb|EXJ54124.1| 50S ribosomal protein L33, partial [Cladophialophora yegresii CBS 114405] Length = 57 Score = 88.2 bits (217), Expect = 1e-15 Identities = 42/55 (76%), Positives = 49/55 (89%) Frame = -2 Query: 277 MAKKQKSRIIAVRLLSMAMTGYFKTYTRPRTARPLSFLRYDPIVKQKVLFLEQKR 113 MAKK KSR IAVRLLSMAMTGY++T RPR +RPLS L+YDP+VK++VLFLEQKR Sbjct: 1 MAKKPKSRTIAVRLLSMAMTGYYRTMVRPRASRPLSMLKYDPVVKRQVLFLEQKR 55