BLASTX nr result
ID: Akebia25_contig00065286
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00065286 (333 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKJ74483.1| hypothetical protein FPSE_05233 [Fusarium pseudog... 77 3e-12 gb|EKG20083.1| Short-chain dehydrogenase/reductase SDR, partial ... 75 1e-11 ref|XP_001592565.1| hypothetical protein SS1G_06806 [Sclerotinia... 74 2e-11 ref|XP_001556655.1| hypothetical protein BC1G_04040 [Botryotinia... 74 2e-11 ref|XP_003843365.1| similar to short-chain dehydrogenase/reducta... 74 3e-11 gb|EXM26986.1| 3-oxoacyl-[acyl-carrier protein] reductase [Fusar... 73 4e-11 gb|EWZ35932.1| 3-oxoacyl-[acyl-carrier protein] reductase [Fusar... 73 4e-11 gb|EWY85483.1| 3-oxoacyl-[acyl-carrier protein] reductase [Fusar... 73 4e-11 gb|EWG51128.1| 3-oxoacyl-[acyl-carrier protein] reductase [Fusar... 73 4e-11 emb|CCT73710.1| related to 3-oxoacyl-(acyl carrier protein) redu... 73 4e-11 gb|EPE26829.1| NAD(P)-binding Rossmann-fold containing protein [... 73 4e-11 gb|EGU85209.1| hypothetical protein FOXB_04230 [Fusarium oxyspor... 73 4e-11 gb|EYB32258.1| hypothetical protein FG05_04045 [Fusarium gramine... 73 5e-11 ref|XP_384221.1| hypothetical protein FG04045.1 [Fusarium gramin... 73 5e-11 gb|EUC47180.1| hypothetical protein COCMIDRAFT_24945 [Bipolaris ... 73 5e-11 gb|EUC37109.1| hypothetical protein COCCADRAFT_86473 [Bipolaris ... 73 5e-11 ref|XP_007583858.1| putative 3-oxoacyl-(acyl-carrier-protein) re... 73 5e-11 gb|EOA82728.1| hypothetical protein SETTUDRAFT_165140 [Setosphae... 73 5e-11 gb|EMD60951.1| hypothetical protein COCSADRAFT_149306 [Bipolaris... 73 5e-11 ref|XP_003298772.1| hypothetical protein PTT_09583 [Pyrenophora ... 73 5e-11 >gb|EKJ74483.1| hypothetical protein FPSE_05233 [Fusarium pseudograminearum CS3096] Length = 288 Score = 76.6 bits (187), Expect = 3e-12 Identities = 35/43 (81%), Positives = 40/43 (93%) Frame = +2 Query: 203 GQIAGHLNYPRGLLAGQVAIVTGAAQGIGAEVAKAFAREGAKV 331 GQ+AGHLNYP+GLLAGQVAI+TG+ QGIGAE AK FA+EGAKV Sbjct: 6 GQLAGHLNYPKGLLAGQVAIITGSGQGIGAEAAKLFAKEGAKV 48 >gb|EKG20083.1| Short-chain dehydrogenase/reductase SDR, partial [Macrophomina phaseolina MS6] Length = 57 Score = 74.7 bits (182), Expect = 1e-11 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = +2 Query: 206 QIAGHLNYPRGLLAGQVAIVTGAAQGIGAEVAKAFAREGAKV 331 QIAGHLNYP+GLLAGQVAI+TG+ QGIGAE AK FA+EGAKV Sbjct: 9 QIAGHLNYPQGLLAGQVAIITGSGQGIGAEAAKLFAKEGAKV 50 >ref|XP_001592565.1| hypothetical protein SS1G_06806 [Sclerotinia sclerotiorum 1980] gi|154704584|gb|EDO04323.1| hypothetical protein SS1G_06806 [Sclerotinia sclerotiorum 1980 UF-70] Length = 288 Score = 74.3 bits (181), Expect = 2e-11 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = +2 Query: 206 QIAGHLNYPRGLLAGQVAIVTGAAQGIGAEVAKAFAREGAKV 331 QIAGHLNYP+GLLAGQVAI+TG+ QGIGAE AK FA EGAKV Sbjct: 7 QIAGHLNYPKGLLAGQVAIITGSGQGIGAETAKLFANEGAKV 48 >ref|XP_001556655.1| hypothetical protein BC1G_04040 [Botryotinia fuckeliana B05.10] gi|347831970|emb|CCD47667.1| similar to short-chain dehydrogenase/reductase sdr [Botryotinia fuckeliana T4] gi|472241795|gb|EMR86506.1| putative 3-oxoacyl-(acyl-carrier-protein) reductase protein [Botryotinia fuckeliana BcDW1] Length = 288 Score = 74.3 bits (181), Expect = 2e-11 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = +2 Query: 206 QIAGHLNYPRGLLAGQVAIVTGAAQGIGAEVAKAFAREGAKV 331 QIAGHLNYP+GLLAGQVAI+TG+ QGIGAE AK FA EGAKV Sbjct: 7 QIAGHLNYPKGLLAGQVAIITGSGQGIGAETAKLFANEGAKV 48 >ref|XP_003843365.1| similar to short-chain dehydrogenase/reductase SDR [Leptosphaeria maculans JN3] gi|312219944|emb|CBX99886.1| similar to short-chain dehydrogenase/reductase SDR [Leptosphaeria maculans JN3] Length = 289 Score = 73.6 bits (179), Expect = 3e-11 Identities = 34/42 (80%), Positives = 38/42 (90%) Frame = +2 Query: 206 QIAGHLNYPRGLLAGQVAIVTGAAQGIGAEVAKAFAREGAKV 331 QIAGHLNYP+G+LAGQ AI+TG+ QGIGAE AK FAREGAKV Sbjct: 7 QIAGHLNYPQGMLAGQTAIITGSGQGIGAEAAKLFAREGAKV 48 >gb|EXM26986.1| 3-oxoacyl-[acyl-carrier protein] reductase [Fusarium oxysporum f. sp. vasinfectum 25433] Length = 288 Score = 73.2 bits (178), Expect = 4e-11 Identities = 33/42 (78%), Positives = 39/42 (92%) Frame = +2 Query: 206 QIAGHLNYPRGLLAGQVAIVTGAAQGIGAEVAKAFAREGAKV 331 Q+AGHLNYP+GLLAGQVAI+TG+ QGIGAE A+ FA+EGAKV Sbjct: 7 QLAGHLNYPKGLLAGQVAIITGSGQGIGAEAARLFAKEGAKV 48 >gb|EWZ35932.1| 3-oxoacyl-[acyl-carrier protein] reductase [Fusarium oxysporum Fo47] Length = 288 Score = 73.2 bits (178), Expect = 4e-11 Identities = 33/42 (78%), Positives = 39/42 (92%) Frame = +2 Query: 206 QIAGHLNYPRGLLAGQVAIVTGAAQGIGAEVAKAFAREGAKV 331 Q+AGHLNYP+GLLAGQVAI+TG+ QGIGAE A+ FA+EGAKV Sbjct: 7 QLAGHLNYPKGLLAGQVAIITGSGQGIGAEAARLFAKEGAKV 48 >gb|EWY85483.1| 3-oxoacyl-[acyl-carrier protein] reductase [Fusarium oxysporum FOSC 3-a] Length = 288 Score = 73.2 bits (178), Expect = 4e-11 Identities = 33/42 (78%), Positives = 39/42 (92%) Frame = +2 Query: 206 QIAGHLNYPRGLLAGQVAIVTGAAQGIGAEVAKAFAREGAKV 331 Q+AGHLNYP+GLLAGQVAI+TG+ QGIGAE A+ FA+EGAKV Sbjct: 7 QLAGHLNYPKGLLAGQVAIITGSGQGIGAEAARLFAKEGAKV 48 >gb|EWG51128.1| 3-oxoacyl-[acyl-carrier protein] reductase [Fusarium verticillioides 7600] Length = 288 Score = 73.2 bits (178), Expect = 4e-11 Identities = 33/42 (78%), Positives = 39/42 (92%) Frame = +2 Query: 206 QIAGHLNYPRGLLAGQVAIVTGAAQGIGAEVAKAFAREGAKV 331 Q+AGHLNYP+GLLAGQVAI+TG+ QGIGAE A+ FA+EGAKV Sbjct: 7 QLAGHLNYPKGLLAGQVAIITGSGQGIGAEAARLFAKEGAKV 48 >emb|CCT73710.1| related to 3-oxoacyl-(acyl carrier protein) reductase [Fusarium fujikuroi IMI 58289] Length = 288 Score = 73.2 bits (178), Expect = 4e-11 Identities = 33/42 (78%), Positives = 39/42 (92%) Frame = +2 Query: 206 QIAGHLNYPRGLLAGQVAIVTGAAQGIGAEVAKAFAREGAKV 331 Q+AGHLNYP+GLLAGQVAI+TG+ QGIGAE A+ FA+EGAKV Sbjct: 7 QLAGHLNYPKGLLAGQVAIITGSGQGIGAEAARLFAKEGAKV 48 >gb|EPE26829.1| NAD(P)-binding Rossmann-fold containing protein [Glarea lozoyensis ATCC 20868] Length = 343 Score = 73.2 bits (178), Expect = 4e-11 Identities = 34/42 (80%), Positives = 38/42 (90%) Frame = +2 Query: 206 QIAGHLNYPRGLLAGQVAIVTGAAQGIGAEVAKAFAREGAKV 331 QIAGHLNYP+GLLAGQVAI+TG+ QGIGAE A+ FA EGAKV Sbjct: 7 QIAGHLNYPKGLLAGQVAIITGSGQGIGAEAARLFANEGAKV 48 >gb|EGU85209.1| hypothetical protein FOXB_04230 [Fusarium oxysporum Fo5176] gi|475668038|gb|EMT65826.1| 3-oxoacyl-[acyl-carrier-protein] reductase FabG [Fusarium oxysporum f. sp. cubense race 4] gi|477522976|gb|ENH75009.1| 3-oxoacyl-[acyl-carrier-protein] reductase FabG [Fusarium oxysporum f. sp. cubense race 1] gi|587724728|gb|EWZ96065.1| 3-oxoacyl-[acyl-carrier protein] reductase [Fusarium oxysporum f. sp. lycopersici MN25] gi|587740349|gb|EXA38065.1| 3-oxoacyl-[acyl-carrier protein] reductase [Fusarium oxysporum f. sp. pisi HDV247] gi|590062115|gb|EXK89639.1| 3-oxoacyl-[acyl-carrier protein] reductase [Fusarium oxysporum f. sp. raphani 54005] gi|591420339|gb|EXL55476.1| 3-oxoacyl-[acyl-carrier protein] reductase [Fusarium oxysporum f. sp. radicis-lycopersici 26381] gi|591443917|gb|EXL76466.1| 3-oxoacyl-[acyl-carrier protein] reductase [Fusarium oxysporum f. sp. conglutinans race 2 54008] gi|591474263|gb|EXM05452.1| 3-oxoacyl-[acyl-carrier protein] reductase [Fusarium oxysporum f. sp. cubense tropical race 4 54006] Length = 288 Score = 73.2 bits (178), Expect = 4e-11 Identities = 33/42 (78%), Positives = 39/42 (92%) Frame = +2 Query: 206 QIAGHLNYPRGLLAGQVAIVTGAAQGIGAEVAKAFAREGAKV 331 Q+AGHLNYP+GLLAGQVAI+TG+ QGIGAE A+ FA+EGAKV Sbjct: 7 QLAGHLNYPKGLLAGQVAIITGSGQGIGAEAARLFAKEGAKV 48 >gb|EYB32258.1| hypothetical protein FG05_04045 [Fusarium graminearum] Length = 288 Score = 72.8 bits (177), Expect = 5e-11 Identities = 33/42 (78%), Positives = 38/42 (90%) Frame = +2 Query: 206 QIAGHLNYPRGLLAGQVAIVTGAAQGIGAEVAKAFAREGAKV 331 Q+ GHLNYP+GLLAGQVAI+TG+ QGIGAE AK FA+EGAKV Sbjct: 7 QLTGHLNYPKGLLAGQVAIITGSGQGIGAEAAKLFAKEGAKV 48 >ref|XP_384221.1| hypothetical protein FG04045.1 [Fusarium graminearum PH-1] gi|558859026|gb|ESU09109.1| hypothetical protein FGSG_04045 [Fusarium graminearum PH-1] Length = 288 Score = 72.8 bits (177), Expect = 5e-11 Identities = 33/42 (78%), Positives = 38/42 (90%) Frame = +2 Query: 206 QIAGHLNYPRGLLAGQVAIVTGAAQGIGAEVAKAFAREGAKV 331 Q+ GHLNYP+GLLAGQVAI+TG+ QGIGAE AK FA+EGAKV Sbjct: 7 QLTGHLNYPKGLLAGQVAIITGSGQGIGAEAAKLFAKEGAKV 48 >gb|EUC47180.1| hypothetical protein COCMIDRAFT_24945 [Bipolaris oryzae ATCC 44560] Length = 291 Score = 72.8 bits (177), Expect = 5e-11 Identities = 33/42 (78%), Positives = 38/42 (90%) Frame = +2 Query: 206 QIAGHLNYPRGLLAGQVAIVTGAAQGIGAEVAKAFAREGAKV 331 QIAGHLNYP+G+LAGQ AI+TG+ QGIGAE AK FA+EGAKV Sbjct: 9 QIAGHLNYPKGMLAGQTAIITGSGQGIGAEAAKLFAKEGAKV 50 >gb|EUC37109.1| hypothetical protein COCCADRAFT_86473 [Bipolaris zeicola 26-R-13] gi|578489123|gb|EUN26559.1| hypothetical protein COCVIDRAFT_100474 [Bipolaris victoriae FI3] Length = 291 Score = 72.8 bits (177), Expect = 5e-11 Identities = 33/42 (78%), Positives = 38/42 (90%) Frame = +2 Query: 206 QIAGHLNYPRGLLAGQVAIVTGAAQGIGAEVAKAFAREGAKV 331 QIAGHLNYP+G+LAGQ AI+TG+ QGIGAE AK FA+EGAKV Sbjct: 9 QIAGHLNYPKGMLAGQTAIITGSGQGIGAEAAKLFAKEGAKV 50 >ref|XP_007583858.1| putative 3-oxoacyl-(acyl-carrier-protein) reductase protein [Neofusicoccum parvum UCRNP2] gi|485923492|gb|EOD48641.1| putative 3-oxoacyl-(acyl-carrier-protein) reductase protein [Neofusicoccum parvum UCRNP2] Length = 290 Score = 72.8 bits (177), Expect = 5e-11 Identities = 34/42 (80%), Positives = 38/42 (90%) Frame = +2 Query: 206 QIAGHLNYPRGLLAGQVAIVTGAAQGIGAEVAKAFAREGAKV 331 QIAGHLN+P+GLLAGQVAI+TG+ QGIGAE AK FA EGAKV Sbjct: 9 QIAGHLNFPKGLLAGQVAIITGSGQGIGAEAAKLFANEGAKV 50 >gb|EOA82728.1| hypothetical protein SETTUDRAFT_165140 [Setosphaeria turcica Et28A] Length = 291 Score = 72.8 bits (177), Expect = 5e-11 Identities = 33/42 (78%), Positives = 38/42 (90%) Frame = +2 Query: 206 QIAGHLNYPRGLLAGQVAIVTGAAQGIGAEVAKAFAREGAKV 331 QIAGHLNYP+G+LAGQ AI+TG+ QGIGAE AK FA+EGAKV Sbjct: 10 QIAGHLNYPKGMLAGQTAIITGSGQGIGAEAAKLFAKEGAKV 51 >gb|EMD60951.1| hypothetical protein COCSADRAFT_149306 [Bipolaris sorokiniana ND90Pr] Length = 291 Score = 72.8 bits (177), Expect = 5e-11 Identities = 33/42 (78%), Positives = 38/42 (90%) Frame = +2 Query: 206 QIAGHLNYPRGLLAGQVAIVTGAAQGIGAEVAKAFAREGAKV 331 QIAGHLNYP+G+LAGQ AI+TG+ QGIGAE AK FA+EGAKV Sbjct: 9 QIAGHLNYPKGMLAGQTAIITGSGQGIGAEAAKLFAKEGAKV 50 >ref|XP_003298772.1| hypothetical protein PTT_09583 [Pyrenophora teres f. teres 0-1] gi|311327874|gb|EFQ93133.1| hypothetical protein PTT_09583 [Pyrenophora teres f. teres 0-1] Length = 290 Score = 72.8 bits (177), Expect = 5e-11 Identities = 33/42 (78%), Positives = 38/42 (90%) Frame = +2 Query: 206 QIAGHLNYPRGLLAGQVAIVTGAAQGIGAEVAKAFAREGAKV 331 QIAGHLNYPRG+LAGQ AI+TG+ QGIGAE A+ FA+EGAKV Sbjct: 9 QIAGHLNYPRGMLAGQTAIITGSGQGIGAEAARLFAKEGAKV 50