BLASTX nr result
ID: Akebia25_contig00065193
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00065193 (253 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003602049.1| hypothetical protein MTR_3g088400 [Medicago ... 61 1e-07 ref|XP_002520331.1| conserved hypothetical protein [Ricinus comm... 59 5e-07 ref|XP_004502517.1| PREDICTED: uncharacterized protein LOC101496... 56 4e-06 gb|EXB60118.1| hypothetical protein L484_013383 [Morus notabilis] 56 6e-06 >ref|XP_003602049.1| hypothetical protein MTR_3g088400 [Medicago truncatula] gi|357520349|ref|XP_003630463.1| hypothetical protein MTR_8g095810 [Medicago truncatula] gi|355491097|gb|AES72300.1| hypothetical protein MTR_3g088400 [Medicago truncatula] gi|355524485|gb|AET04939.1| hypothetical protein MTR_8g095810 [Medicago truncatula] Length = 169 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/50 (54%), Positives = 32/50 (64%), Gaps = 4/50 (8%) Frame = +1 Query: 4 DESFKKEGTVPFKWEIRPGTPKPHHHHYQQR----QLTPPPAGSGFSVSP 141 D SFKK G+VPFKWEI+PG P PHHHH +L PPP + +SP Sbjct: 6 DYSFKKPGSVPFKWEIKPGLPIPHHHHQNPESPSFKLKPPPQLGSYKLSP 55 >ref|XP_002520331.1| conserved hypothetical protein [Ricinus communis] gi|223540550|gb|EEF42117.1| conserved hypothetical protein [Ricinus communis] Length = 196 Score = 59.3 bits (142), Expect = 5e-07 Identities = 30/48 (62%), Positives = 33/48 (68%) Frame = +1 Query: 1 IDESFKKEGTVPFKWEIRPGTPKPHHHHYQQRQLTPPPAGSGFSVSPP 144 ID+SFKK G VPFKWEIRPG PK HH Q +QL+PP S SPP Sbjct: 3 IDDSFKKPGAVPFKWEIRPGVPKIQHHQ-QPKQLSPPKLP---SPSPP 46 >ref|XP_004502517.1| PREDICTED: uncharacterized protein LOC101496117 [Cicer arietinum] Length = 142 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/44 (56%), Positives = 28/44 (63%), Gaps = 4/44 (9%) Frame = +1 Query: 4 DESFKKEGTVPFKWEIRPGTPKPHHHHYQQ----RQLTPPPAGS 123 D+SFKK G VPFKWEI+PG P HHHH + PPP GS Sbjct: 6 DDSFKKPGAVPFKWEIKPGLPISHHHHNPDSPSLKLRAPPPLGS 49 >gb|EXB60118.1| hypothetical protein L484_013383 [Morus notabilis] Length = 170 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/61 (45%), Positives = 33/61 (54%), Gaps = 13/61 (21%) Frame = +1 Query: 1 IDESFKKEGTVPFKWEIRPGTPKPHHHHYQQRQ-------------LTPPPAGSGFSVSP 141 +D+SFKK G+VPFKWEI+PG PK Q +Q L PPPAG F P Sbjct: 3 VDDSFKKPGSVPFKWEIKPGVPKVQSQQQQTKQQPPLQEPPSPLRKLRPPPAGLVFVPPP 62 Query: 142 P 144 P Sbjct: 63 P 63