BLASTX nr result
ID: Akebia25_contig00065189
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00065189 (250 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG21232.1| Cupin 2 conserved barrel [Macrophomina phaseolina... 69 7e-10 ref|XP_007586352.1| putative iron sulfur cluster assembly protei... 65 1e-08 ref|XP_003851666.1| hypothetical protein MYCGRDRAFT_73582 [Zymos... 64 3e-08 gb|EME81389.1| hypothetical protein MYCFIDRAFT_204296 [Pseudocer... 63 4e-08 gb|EME42165.1| hypothetical protein DOTSEDRAFT_64031 [Dothistrom... 61 2e-07 gb|EON67954.1| hypothetical protein W97_07451 [Coniosporium apol... 60 2e-07 gb|EUN26317.1| hypothetical protein COCVIDRAFT_101148 [Bipolaris... 59 5e-07 gb|EUC51357.1| hypothetical protein COCMIDRAFT_79874 [Bipolaris ... 59 5e-07 gb|EUC30124.1| hypothetical protein COCCADRAFT_104727 [Bipolaris... 59 5e-07 gb|ERF73814.1| Iron sulfur cluster assembly protein 1 [Endocarpo... 59 5e-07 gb|EMD97102.1| hypothetical protein COCHEDRAFT_1087225 [Bipolari... 59 5e-07 gb|EMD66523.1| hypothetical protein COCSADRAFT_35035 [Bipolaris ... 59 5e-07 gb|EMF12877.1| FeS cluster assembly scaffold IscU [Sphaerulina m... 58 1e-06 gb|EPE34470.1| SufE/NifU [Glarea lozoyensis ATCC 20868] 58 2e-06 ref|XP_003297530.1| hypothetical protein PTT_07956 [Pyrenophora ... 57 3e-06 ref|XP_001942016.1| iron sulfur cluster assembly protein 1, mito... 57 3e-06 gb|EOA84917.1| hypothetical protein SETTUDRAFT_91320 [Setosphaer... 57 3e-06 ref|XP_003845505.1| similar to iron sulfur cluster assembly prot... 57 3e-06 ref|XP_001793486.1| hypothetical protein SNOG_02892 [Phaeosphaer... 57 3e-06 gb|ESZ97567.1| iron sulfur cluster assembly protein [Sclerotinia... 56 6e-06 >gb|EKG21232.1| Cupin 2 conserved barrel [Macrophomina phaseolina MS6] Length = 139 Score = 68.9 bits (167), Expect = 7e-10 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = -1 Query: 250 ISNYYTKNPKARKTDLGGTGAALPKIEVETITSSQPSASAA 128 ISNYYTKNPKAR+TDLGGTGA LPK+EVETIT + PSA+AA Sbjct: 100 ISNYYTKNPKARQTDLGGTGAPLPKVEVETITET-PSAAAA 139 >ref|XP_007586352.1| putative iron sulfur cluster assembly protein 1 protein [Neofusicoccum parvum UCRNP2] gi|485920054|gb|EOD46183.1| putative iron sulfur cluster assembly protein 1 protein [Neofusicoccum parvum UCRNP2] Length = 138 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/39 (71%), Positives = 35/39 (89%) Frame = -1 Query: 250 ISNYYTKNPKARKTDLGGTGAALPKIEVETITSSQPSAS 134 ISNYYTKNPKAR+TDLGGTGA+LPK+EVET+ + +A+ Sbjct: 100 ISNYYTKNPKARQTDLGGTGASLPKVEVETVVETNAAAA 138 >ref|XP_003851666.1| hypothetical protein MYCGRDRAFT_73582 [Zymoseptoria tritici IPO323] gi|339471546|gb|EGP86642.1| hypothetical protein MYCGRDRAFT_73582 [Zymoseptoria tritici IPO323] Length = 198 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -1 Query: 250 ISNYYTKNPKARKTDLGGTGAALPKIEVETITSSQPSASAA 128 ISNYYTKNPKAR TDLGGTGAA+PKIE+E + + P+ ++A Sbjct: 158 ISNYYTKNPKARATDLGGTGAAMPKIEIEKLPADVPAQASA 198 >gb|EME81389.1| hypothetical protein MYCFIDRAFT_204296 [Pseudocercospora fijiensis CIRAD86] Length = 140 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -1 Query: 250 ISNYYTKNPKARKTDLGGTGAALPKIEVETITSSQPSASAA 128 ISNYYTKNPKAR TDLGGTGAA+PKIE+E + + +A+A+ Sbjct: 100 ISNYYTKNPKARATDLGGTGAAMPKIEIEKVPADASTAAAS 140 >gb|EME42165.1| hypothetical protein DOTSEDRAFT_64031 [Dothistroma septosporum NZE10] Length = 205 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 3/40 (7%) Frame = -1 Query: 250 ISNYYTKNPKARKTDLGGTGAALPKIEVETITSS---QPS 140 I+NYYTKNPKAR TDLGGTGAA+PKIE+E I S+ QPS Sbjct: 165 INNYYTKNPKARATDLGGTGAAMPKIEIEKIGSNDNVQPS 204 >gb|EON67954.1| hypothetical protein W97_07451 [Coniosporium apollinis CBS 100218] Length = 199 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -1 Query: 250 ISNYYTKNPKARKTDLGGTGAALPKIEVETITS 152 ISNYYTKNPKAR TDLGGTGAA+PK+EVE + + Sbjct: 167 ISNYYTKNPKARATDLGGTGAAMPKVEVEAVAA 199 >gb|EUN26317.1| hypothetical protein COCVIDRAFT_101148 [Bipolaris victoriae FI3] Length = 200 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -1 Query: 250 ISNYYTKNPKARKTDLGGTGAALPKIEVETITSS 149 ISNYYTKNPKAR+TDLGG A LPK+EVET++S+ Sbjct: 165 ISNYYTKNPKARQTDLGGKSAPLPKVEVETVSSA 198 >gb|EUC51357.1| hypothetical protein COCMIDRAFT_79874 [Bipolaris oryzae ATCC 44560] Length = 204 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -1 Query: 250 ISNYYTKNPKARKTDLGGTGAALPKIEVETITSS 149 ISNYYTKNPKAR+TDLGG A LPK+EVET++S+ Sbjct: 169 ISNYYTKNPKARQTDLGGKSAPLPKVEVETVSSA 202 >gb|EUC30124.1| hypothetical protein COCCADRAFT_104727 [Bipolaris zeicola 26-R-13] Length = 200 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -1 Query: 250 ISNYYTKNPKARKTDLGGTGAALPKIEVETITSS 149 ISNYYTKNPKAR+TDLGG A LPK+EVET++S+ Sbjct: 165 ISNYYTKNPKARQTDLGGKSAPLPKVEVETVSSA 198 >gb|ERF73814.1| Iron sulfur cluster assembly protein 1 [Endocarpon pusillum Z07020] Length = 196 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -1 Query: 250 ISNYYTKNPKARKTDLGGTGAALPKIEVETITSSQPSA 137 ISNYYTKNPKAR TDLGGTGA++PKIEVE + A Sbjct: 159 ISNYYTKNPKARATDLGGTGASMPKIEVEQVAQETAMA 196 >gb|EMD97102.1| hypothetical protein COCHEDRAFT_1087225 [Bipolaris maydis C5] gi|477587350|gb|ENI04432.1| hypothetical protein COCC4DRAFT_171172 [Bipolaris maydis ATCC 48331] Length = 199 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -1 Query: 250 ISNYYTKNPKARKTDLGGTGAALPKIEVETITSS 149 ISNYYTKNPKAR+TDLGG A LPK+EVET++S+ Sbjct: 164 ISNYYTKNPKARQTDLGGKSAPLPKVEVETVSSA 197 >gb|EMD66523.1| hypothetical protein COCSADRAFT_35035 [Bipolaris sorokiniana ND90Pr] Length = 195 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -1 Query: 250 ISNYYTKNPKARKTDLGGTGAALPKIEVETITSS 149 ISNYYTKNPKAR+TDLGG A LPK+EVET++S+ Sbjct: 160 ISNYYTKNPKARQTDLGGKSAPLPKVEVETVSSA 193 >gb|EMF12877.1| FeS cluster assembly scaffold IscU [Sphaerulina musiva SO2202] Length = 199 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = -1 Query: 250 ISNYYTKNPKARKTDLGGTGAALPKIEVETITSS 149 I+NYYTKNPK + TDLGGTGA +PKIEVET+++S Sbjct: 165 INNYYTKNPKQKATDLGGTGAHMPKIEVETVSAS 198 >gb|EPE34470.1| SufE/NifU [Glarea lozoyensis ATCC 20868] Length = 201 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/41 (65%), Positives = 31/41 (75%) Frame = -1 Query: 250 ISNYYTKNPKARKTDLGGTGAALPKIEVETITSSQPSASAA 128 ISNYYTKNP AR T LGGT AA+PKI+VET+ S +AA Sbjct: 160 ISNYYTKNPNARSTSLGGTSAAMPKIDVETVMEPASSHTAA 200 >ref|XP_003297530.1| hypothetical protein PTT_07956 [Pyrenophora teres f. teres 0-1] gi|311329767|gb|EFQ94390.1| hypothetical protein PTT_07956 [Pyrenophora teres f. teres 0-1] Length = 163 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = -1 Query: 250 ISNYYTKNPKARKTDLGGTGAALPKIEVETITSS 149 ISNYYTKNP AR+TDLGG A LPK+E+ET++S+ Sbjct: 128 ISNYYTKNPNARQTDLGGKSAPLPKVEIETVSSA 161 >ref|XP_001942016.1| iron sulfur cluster assembly protein 1, mitochondrial precursor [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187978109|gb|EDU44735.1| iron sulfur cluster assembly protein 1, mitochondrial precursor [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 135 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = -1 Query: 250 ISNYYTKNPKARKTDLGGTGAALPKIEVETITSS 149 ISNYYTKNP AR+TDLGG A LPK+E+ET++S+ Sbjct: 100 ISNYYTKNPNARQTDLGGKSAPLPKVEIETVSSA 133 >gb|EOA84917.1| hypothetical protein SETTUDRAFT_91320 [Setosphaeria turcica Et28A] Length = 213 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = -1 Query: 250 ISNYYTKNPKARKTDLGGTGAALPKIEVETITSS 149 ISNYYTKNP AR+TDLGG A +PK+EVET++S+ Sbjct: 178 ISNYYTKNPNARQTDLGGKSAPMPKVEVETVSSA 211 >ref|XP_003845505.1| similar to iron sulfur cluster assembly protein 1 [Leptosphaeria maculans JN3] gi|312222086|emb|CBY02026.1| similar to iron sulfur cluster assembly protein 1 [Leptosphaeria maculans JN3] Length = 199 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -1 Query: 250 ISNYYTKNPKARKTDLGGTGAALPKIEVETITSS 149 ISNYYTKNP AR TDLGG A LPK+EVET++S+ Sbjct: 164 ISNYYTKNPNARATDLGGKSAPLPKVEVETVSST 197 >ref|XP_001793486.1| hypothetical protein SNOG_02892 [Phaeosphaeria nodorum SN15] gi|160705383|gb|EAT89623.2| hypothetical protein SNOG_02892 [Phaeosphaeria nodorum SN15] Length = 195 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -1 Query: 250 ISNYYTKNPKARKTDLGGTGAALPKIEVETITSS 149 ISNYYTKNP AR TDLGG A LPK+EVET++S+ Sbjct: 160 ISNYYTKNPNARATDLGGKSAPLPKVEVETVSSA 193 >gb|ESZ97567.1| iron sulfur cluster assembly protein [Sclerotinia borealis F-4157] Length = 201 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/31 (74%), Positives = 30/31 (96%) Frame = -1 Query: 250 ISNYYTKNPKARKTDLGGTGAALPKIEVETI 158 ISNYYTKNPK++ T+LGGTGA++PKI+VET+ Sbjct: 160 ISNYYTKNPKSQSTNLGGTGASMPKIDVETV 190