BLASTX nr result
ID: Akebia25_contig00065114
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00065114 (322 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006339048.1| PREDICTED: pentatricopeptide repeat-containi... 104 1e-20 ref|XP_004249810.1| PREDICTED: pentatricopeptide repeat-containi... 101 9e-20 ref|XP_004508135.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 ref|XP_004151347.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 emb|CBI27471.3| unnamed protein product [Vitis vinifera] 64 2e-08 ref|XP_002272744.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 emb|CAN66581.1| hypothetical protein VITISV_030261 [Vitis vinifera] 64 2e-08 ref|XP_006477473.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 ref|XP_006437177.1| hypothetical protein CICLE_v10031197mg [Citr... 64 3e-08 ref|XP_002306741.1| pentatricopeptide repeat-containing family p... 63 4e-08 ref|XP_006440623.1| hypothetical protein CICLE_v10020040mg [Citr... 62 6e-08 gb|EXB44509.1| hypothetical protein L484_000760 [Morus notabilis... 62 8e-08 ref|XP_006484869.1| PREDICTED: pentatricopeptide repeat-containi... 62 8e-08 gb|EXB86239.1| hypothetical protein L484_005950 [Morus notabilis] 61 1e-07 ref|XP_002279693.1| PREDICTED: pentatricopeptide repeat-containi... 61 1e-07 emb|CAN69807.1| hypothetical protein VITISV_019655 [Vitis vinifera] 61 1e-07 ref|XP_006425654.1| hypothetical protein CICLE_v10025166mg [Citr... 61 2e-07 gb|EYU29595.1| hypothetical protein MIMGU_mgv1a025435mg [Mimulus... 60 2e-07 ref|XP_004306131.1| PREDICTED: pentatricopeptide repeat-containi... 60 2e-07 ref|XP_007210182.1| hypothetical protein PRUPE_ppa020166mg [Prun... 60 2e-07 >ref|XP_006339048.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Solanum tuberosum] Length = 680 Score = 104 bits (259), Expect = 1e-20 Identities = 47/67 (70%), Positives = 53/67 (79%) Frame = +3 Query: 117 HVCLIRTGLHQSSFAVGNFLARCATLGTMGYANQVFDQMLEPNSFVWNTIIRGFQQNQEP 296 HV L+RTGLH SSFAVGNF+ CA+LG M YA Q+FDQM EPNSFVWNT+IRGFQQN P Sbjct: 35 HVYLLRTGLHHSSFAVGNFITHCASLGLMSYAAQLFDQMSEPNSFVWNTLIRGFQQNHSP 94 Query: 297 NKALVFF 317 L +F Sbjct: 95 KYTLYYF 101 >ref|XP_004249810.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Solanum lycopersicum] Length = 676 Score = 101 bits (252), Expect = 9e-20 Identities = 46/67 (68%), Positives = 54/67 (80%) Frame = +3 Query: 117 HVCLIRTGLHQSSFAVGNFLARCATLGTMGYANQVFDQMLEPNSFVWNTIIRGFQQNQEP 296 HV L+RTGLH+SSFAVGNF+ CA+LG M YA +FDQM EPNSFVWNT+IRGFQQN+ P Sbjct: 31 HVYLLRTGLHRSSFAVGNFITHCASLGLMSYAALLFDQMPEPNSFVWNTLIRGFQQNRAP 90 Query: 297 NKALVFF 317 L +F Sbjct: 91 KYTLYYF 97 >ref|XP_004508135.1| PREDICTED: pentatricopeptide repeat-containing protein At1g59720, mitochondrial-like isoform X1 [Cicer arietinum] gi|502150812|ref|XP_004508136.1| PREDICTED: pentatricopeptide repeat-containing protein At1g59720, mitochondrial-like isoform X2 [Cicer arietinum] gi|502150814|ref|XP_004508137.1| PREDICTED: pentatricopeptide repeat-containing protein At1g59720, mitochondrial-like isoform X3 [Cicer arietinum] gi|502150816|ref|XP_004508138.1| PREDICTED: pentatricopeptide repeat-containing protein At1g59720, mitochondrial-like isoform X4 [Cicer arietinum] gi|502150818|ref|XP_004508139.1| PREDICTED: pentatricopeptide repeat-containing protein At1g59720, mitochondrial-like isoform X5 [Cicer arietinum] Length = 471 Score = 64.3 bits (155), Expect = 2e-08 Identities = 26/67 (38%), Positives = 42/67 (62%) Frame = +3 Query: 117 HVCLIRTGLHQSSFAVGNFLARCATLGTMGYANQVFDQMLEPNSFVWNTIIRGFQQNQEP 296 H +I++G H + GN + CA M YA +F+ + +P+SF+WNT+IRGF + +P Sbjct: 32 HARIIQSGFHHNLLITGNIIMFCAVSNNMNYALSLFNTIRKPDSFIWNTMIRGFGNSTQP 91 Query: 297 NKALVFF 317 KA+ F+ Sbjct: 92 QKAIHFY 98 >ref|XP_004151347.1| PREDICTED: pentatricopeptide repeat-containing protein At2g42920, chloroplastic-like [Cucumis sativus] gi|449530724|ref|XP_004172343.1| PREDICTED: pentatricopeptide repeat-containing protein At2g42920, chloroplastic-like [Cucumis sativus] Length = 543 Score = 64.3 bits (155), Expect = 2e-08 Identities = 35/68 (51%), Positives = 40/68 (58%), Gaps = 1/68 (1%) Frame = +3 Query: 117 HVCLIRTGLHQSSFAVGNFLARCAT-LGTMGYANQVFDQMLEPNSFVWNTIIRGFQQNQE 293 H LI++G SFA LA CA+ LG M YA VF QM PN F WNT+IRGF Q+ Sbjct: 44 HAHLIKSGQAIESFAASRILAFCASPLGNMDYAYLVFLQMQNPNLFSWNTVIRGFSQSSN 103 Query: 294 PNKALVFF 317 P AL F Sbjct: 104 PQIALYLF 111 >emb|CBI27471.3| unnamed protein product [Vitis vinifera] Length = 574 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/70 (40%), Positives = 45/70 (64%), Gaps = 2/70 (2%) Frame = +3 Query: 117 HVCLIRTGLHQSSFAVGNFLARCAT--LGTMGYANQVFDQMLEPNSFVWNTIIRGFQQNQ 290 H +++TGL LA CA+ G++ YA VFD++ PN+F+WNT+IRG+ ++ Sbjct: 38 HGQMLKTGLILDEIPASKLLAFCASPNSGSLAYARTVFDRIFRPNTFMWNTMIRGYSNSK 97 Query: 291 EPNKALVFFH 320 EP +AL+ +H Sbjct: 98 EPEEALLLYH 107 >ref|XP_002272744.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Vitis vinifera] Length = 622 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/70 (40%), Positives = 45/70 (64%), Gaps = 2/70 (2%) Frame = +3 Query: 117 HVCLIRTGLHQSSFAVGNFLARCAT--LGTMGYANQVFDQMLEPNSFVWNTIIRGFQQNQ 290 H +++TGL LA CA+ G++ YA VFD++ PN+F+WNT+IRG+ ++ Sbjct: 38 HGQMLKTGLILDEIPASKLLAFCASPNSGSLAYARTVFDRIFRPNTFMWNTMIRGYSNSK 97 Query: 291 EPNKALVFFH 320 EP +AL+ +H Sbjct: 98 EPEEALLLYH 107 >emb|CAN66581.1| hypothetical protein VITISV_030261 [Vitis vinifera] Length = 622 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/70 (40%), Positives = 45/70 (64%), Gaps = 2/70 (2%) Frame = +3 Query: 117 HVCLIRTGLHQSSFAVGNFLARCAT--LGTMGYANQVFDQMLEPNSFVWNTIIRGFQQNQ 290 H +++TGL LA CA+ G++ YA VFD++ PN+F+WNT+IRG+ ++ Sbjct: 38 HGQMLKTGLILDEIPASKLLAFCASPNSGSLAYARTVFDRIFRPNTFMWNTMIRGYSNSK 97 Query: 291 EPNKALVFFH 320 EP +AL+ +H Sbjct: 98 EPEEALLLYH 107 >ref|XP_006477473.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Citrus sinensis] Length = 519 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/69 (42%), Positives = 44/69 (63%), Gaps = 2/69 (2%) Frame = +3 Query: 117 HVCLIRTGLHQSSFAVGNFLARCATL--GTMGYANQVFDQMLEPNSFVWNTIIRGFQQNQ 290 H +IR+G +Q+ F +G + CA G MGYA VF+ + P+ F+WNT+IRGF +N Sbjct: 71 HAQIIRSGQNQTLFVIGKIIVFCAVSEQGDMGYAASVFENIESPDGFLWNTMIRGFSKNC 130 Query: 291 EPNKALVFF 317 +P KA ++ Sbjct: 131 KPVKAFEYY 139 >ref|XP_006437177.1| hypothetical protein CICLE_v10031197mg [Citrus clementina] gi|557539373|gb|ESR50417.1| hypothetical protein CICLE_v10031197mg [Citrus clementina] Length = 534 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/68 (45%), Positives = 41/68 (60%), Gaps = 1/68 (1%) Frame = +3 Query: 117 HVCLIRTGLHQSSFAVGNFLARCAT-LGTMGYANQVFDQMLEPNSFVWNTIIRGFQQNQE 293 H LI+TGL + A LA C + G + YA VF Q+ +PN F+WNTIIRGF Q+ Sbjct: 40 HAHLIKTGLPKDPIAASRILAFCTSPAGDINYAYLVFTQIKKPNLFIWNTIIRGFSQSST 99 Query: 294 PNKALVFF 317 P A++ F Sbjct: 100 PRNAILLF 107 >ref|XP_002306741.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|222856190|gb|EEE93737.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 509 Score = 63.2 bits (152), Expect = 4e-08 Identities = 32/68 (47%), Positives = 41/68 (60%), Gaps = 1/68 (1%) Frame = +3 Query: 117 HVCLIRTGLHQSSFAVGNFLARCAT-LGTMGYANQVFDQMLEPNSFVWNTIIRGFQQNQE 293 H LI+TGL + + A LA C + G + YA VF Q+ PN FVWNTIIRGF Q+ Sbjct: 16 HAQLIKTGLAKDTIAASRVLAFCTSPAGDINYAYLVFTQIRNPNLFVWNTIIRGFSQSST 75 Query: 294 PNKALVFF 317 P+ A+ F Sbjct: 76 PHNAISLF 83 >ref|XP_006440623.1| hypothetical protein CICLE_v10020040mg [Citrus clementina] gi|557542885|gb|ESR53863.1| hypothetical protein CICLE_v10020040mg [Citrus clementina] Length = 465 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/69 (42%), Positives = 43/69 (62%), Gaps = 2/69 (2%) Frame = +3 Query: 117 HVCLIRTGLHQSSFAVGNFLARCATL--GTMGYANQVFDQMLEPNSFVWNTIIRGFQQNQ 290 H +IR+G +Q+ F +G + CA G MGYA VF + P+ F+WNT+IRGF +N Sbjct: 17 HAQIIRSGQNQTLFVIGKIIVFCAVSDQGDMGYAASVFANIESPDGFLWNTMIRGFSKNC 76 Query: 291 EPNKALVFF 317 +P KA ++ Sbjct: 77 KPVKAFEYY 85 >gb|EXB44509.1| hypothetical protein L484_000760 [Morus notabilis] gi|587904202|gb|EXB92403.1| hypothetical protein L484_021387 [Morus notabilis] Length = 530 Score = 62.0 bits (149), Expect = 8e-08 Identities = 31/68 (45%), Positives = 40/68 (58%), Gaps = 1/68 (1%) Frame = +3 Query: 117 HVCLIRTGLHQSSFAVGNFLARCAT-LGTMGYANQVFDQMLEPNSFVWNTIIRGFQQNQE 293 H LI+TGL + A LA CA+ G + YA VF Q+ PN F+WNTIIRGF ++ Sbjct: 46 HAHLIKTGLISHTIASSRLLAFCASPAGNINYALMVFSQIQNPNLFIWNTIIRGFSRSST 105 Query: 294 PNKALVFF 317 P A+ F Sbjct: 106 PQTAIFLF 113 >ref|XP_006484869.1| PREDICTED: pentatricopeptide repeat-containing protein At2g42920, chloroplastic-like [Citrus sinensis] Length = 534 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/68 (44%), Positives = 40/68 (58%), Gaps = 1/68 (1%) Frame = +3 Query: 117 HVCLIRTGLHQSSFAVGNFLARCAT-LGTMGYANQVFDQMLEPNSFVWNTIIRGFQQNQE 293 H LI+TGL + A L C + G + YA VF Q+ +PN F+WNTIIRGF Q+ Sbjct: 40 HAHLIKTGLAKDPIAASRILTFCTSPAGDINYAYLVFTQIKKPNLFIWNTIIRGFSQSST 99 Query: 294 PNKALVFF 317 P A++ F Sbjct: 100 PRNAILLF 107 >gb|EXB86239.1| hypothetical protein L484_005950 [Morus notabilis] Length = 737 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/69 (37%), Positives = 42/69 (60%), Gaps = 2/69 (2%) Frame = +3 Query: 117 HVCLIRTGLHQSSFAVGNFLARCAT--LGTMGYANQVFDQMLEPNSFVWNTIIRGFQQNQ 290 H +I+TGLH++ FA+ + C+ G + YA + D + EPN F+WNT++RG Sbjct: 51 HTHIIKTGLHKTQFALSKLVEFCSLSPFGDLSYALAILDTIEEPNRFIWNTVLRGHSLRS 110 Query: 291 EPNKALVFF 317 +P KA+ F+ Sbjct: 111 DPAKAIDFY 119 >ref|XP_002279693.1| PREDICTED: pentatricopeptide repeat-containing protein At2g42920, chloroplastic [Vitis vinifera] gi|302143555|emb|CBI22116.3| unnamed protein product [Vitis vinifera] Length = 533 Score = 61.2 bits (147), Expect = 1e-07 Identities = 33/69 (47%), Positives = 41/69 (59%), Gaps = 2/69 (2%) Frame = +3 Query: 117 HVCLIRTGLHQSSFAVGNFLARCATL--GTMGYANQVFDQMLEPNSFVWNTIIRGFQQNQ 290 H L++TGL + AV LA CAT G + YA VF Q+ PN F WNTIIRGF Q+ Sbjct: 44 HAHLLKTGLAKHPLAVSPVLAFCATSPGGDINYAYLVFTQIHSPNLFSWNTIIRGFSQSS 103 Query: 291 EPNKALVFF 317 P+ A+ F Sbjct: 104 TPHHAISLF 112 >emb|CAN69807.1| hypothetical protein VITISV_019655 [Vitis vinifera] Length = 516 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/69 (40%), Positives = 44/69 (63%), Gaps = 2/69 (2%) Frame = +3 Query: 117 HVCLIRTGLHQSSFAVGNFLARCAT--LGTMGYANQVFDQMLEPNSFVWNTIIRGFQQNQ 290 H +I+TGL Q+ F +G + CA G+M YA +VF ++ P+ F+WNT+IRG + + Sbjct: 71 HAHVIQTGLEQNLFVMGKIIVFCAVSECGSMDYALRVFGKIENPDGFLWNTMIRGLGRTR 130 Query: 291 EPNKALVFF 317 +P KA F+ Sbjct: 131 QPEKAFEFY 139 >ref|XP_006425654.1| hypothetical protein CICLE_v10025166mg [Citrus clementina] gi|568824869|ref|XP_006466814.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Citrus sinensis] gi|557527644|gb|ESR38894.1| hypothetical protein CICLE_v10025166mg [Citrus clementina] Length = 622 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/69 (36%), Positives = 45/69 (65%), Gaps = 2/69 (2%) Frame = +3 Query: 117 HVCLIRTGLHQSSFAVGNFLARC--ATLGTMGYANQVFDQMLEPNSFVWNTIIRGFQQNQ 290 H + + GL ++ V LA C + G++ YA VFD++++PN+F+WNT++RG+ + Sbjct: 38 HAQMFKKGLTVNTILVSRLLAFCTFSNSGSLAYAQMVFDRIIKPNTFMWNTMVRGYADSS 97 Query: 291 EPNKALVFF 317 EP +AL+ + Sbjct: 98 EPEQALLLY 106 >gb|EYU29595.1| hypothetical protein MIMGU_mgv1a025435mg [Mimulus guttatus] Length = 505 Score = 60.5 bits (145), Expect = 2e-07 Identities = 32/70 (45%), Positives = 41/70 (58%), Gaps = 3/70 (4%) Frame = +3 Query: 117 HVCLIRTGLHQSSFAVGNFLARCATLGT---MGYANQVFDQMLEPNSFVWNTIIRGFQQN 287 H LI+TGL + + AV LA CA G + YA VF + +PN F WNTIIRGF Q+ Sbjct: 25 HAQLIKTGLAKDTIAVSRILAFCAAPGPARDLDYAFSVFSHIEKPNLFTWNTIIRGFCQS 84 Query: 288 QEPNKALVFF 317 P+ A+ F Sbjct: 85 SHPHVAISLF 94 >ref|XP_004306131.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15300-like [Fragaria vesca subsp. vesca] Length = 540 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/69 (40%), Positives = 45/69 (65%), Gaps = 2/69 (2%) Frame = +3 Query: 117 HVCLIRTGLHQSSFAVGN--FLARCATLGTMGYANQVFDQMLEPNSFVWNTIIRGFQQNQ 290 H ++ G + + A+G F + + GT+GYA++VFDQ+ EPN+F+WNT+IRG Q+ Sbjct: 33 HASMVIHGFNSNPSALGELIFASAMSISGTIGYAHKVFDQITEPNTFMWNTMIRGSAQSL 92 Query: 291 EPNKALVFF 317 P A+V + Sbjct: 93 RPLNAVVLY 101 >ref|XP_007210182.1| hypothetical protein PRUPE_ppa020166mg [Prunus persica] gi|462405917|gb|EMJ11381.1| hypothetical protein PRUPE_ppa020166mg [Prunus persica] Length = 443 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/69 (40%), Positives = 42/69 (60%), Gaps = 2/69 (2%) Frame = +3 Query: 117 HVCLIRTGLHQSSFAVGNFLARCATL--GTMGYANQVFDQMLEPNSFVWNTIIRGFQQNQ 290 H +IR G+ Q+ F +G ++ CA G M YA VF + P+ F+WNT+IRGF + + Sbjct: 8 HGHIIRNGVDQNPFVLGKIISFCAVSERGDMNYAASVFSSIENPDGFLWNTMIRGFGKTR 67 Query: 291 EPNKALVFF 317 +P KA F+ Sbjct: 68 KPEKAFEFY 76