BLASTX nr result
ID: Akebia25_contig00065109
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00065109 (242 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB91951.1| hypothetical protein L484_001825 [Morus notabilis] 57 3e-06 >gb|EXB91951.1| hypothetical protein L484_001825 [Morus notabilis] Length = 769 Score = 57.0 bits (136), Expect = 3e-06 Identities = 30/65 (46%), Positives = 41/65 (63%) Frame = -2 Query: 241 DKDGQYVESATKETTDKLDELLKVDEEGSSSNTENNGILPQALKTPEHHVCVRGLGPFVT 62 +K+G+YVE KE DK+D+L K+ +EG +N + IL AL T EH VRG+G VT Sbjct: 631 NKNGEYVEKEAKECADKIDKLTKLVQEGIVANAGRDDILGMALGTAEHSSQVRGVGHSVT 690 Query: 61 LFAFF 47 +FF Sbjct: 691 PKSFF 695