BLASTX nr result
ID: Akebia25_contig00064851
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00064851 (216 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001801808.1| hypothetical protein SNOG_11568 [Phaeosphaer... 70 4e-10 ref|XP_003841083.1| predicted protein [Leptosphaeria maculans JN... 65 7e-09 ref|XP_003305111.1| hypothetical protein PTT_17858 [Pyrenophora ... 63 4e-08 ref|XP_001935129.1| NADH:ubiquinone oxidoreductase 20.1kD subuni... 63 5e-08 gb|EON67091.1| NADH dehydrogenase (ubiquinone) 1 beta subcomplex... 61 2e-07 gb|EMF14393.1| hypothetical protein SEPMUDRAFT_148112 [Sphaeruli... 60 2e-07 ref|XP_003853010.1| hypothetical protein MYCGRDRAFT_104178 [Zymo... 60 3e-07 gb|EUC27106.1| hypothetical protein COCCADRAFT_112558 [Bipolaris... 60 4e-07 dbj|GAD99645.1| conserved hypothetical protein [Byssochlamys spe... 60 4e-07 dbj|GAA91110.1| NADH:ubiquinone oxidoreductase kD subunit [Asper... 59 9e-07 ref|XP_001262872.1| hypothetical protein NFIA_115110 [Neosartory... 59 9e-07 gb|EUC40227.1| hypothetical protein COCMIDRAFT_109337 [Bipolaris... 58 1e-06 gb|EOA91257.1| hypothetical protein SETTUDRAFT_162030 [Setosphae... 58 1e-06 gb|EMD85505.1| hypothetical protein COCHEDRAFT_1024438 [Bipolari... 58 1e-06 gb|EMD59500.1| hypothetical protein COCSADRAFT_40696 [Bipolaris ... 58 1e-06 ref|XP_001584814.1| hypothetical protein SS1G_14269 [Sclerotinia... 58 1e-06 gb|EME46654.1| hypothetical protein DOTSEDRAFT_126442 [Dothistro... 58 2e-06 gb|EEH10848.1| NADH-ubiquinone oxidoreductase [Ajellomyces capsu... 58 2e-06 ref|XP_001540554.1| conserved hypothetical protein [Ajellomyces ... 58 2e-06 ref|XP_001395111.1| NADH:ubiquinone oxidoreductase kD subunit [A... 58 2e-06 >ref|XP_001801808.1| hypothetical protein SNOG_11568 [Phaeosphaeria nodorum SN15] gi|160703264|gb|EAT81276.2| hypothetical protein SNOG_11568 [Phaeosphaeria nodorum SN15] Length = 161 Score = 69.7 bits (169), Expect = 4e-10 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = -2 Query: 212 YTHYKPGFGAILLGTWIASVFGLCGVVSMFYPDKPSVPKTY 90 Y H+ PG+G ILLGT++ASV GLCGVV+M+YPDK S PKTY Sbjct: 96 YDHFTPGWGGILLGTFVASVLGLCGVVAMYYPDKKSAPKTY 136 >ref|XP_003841083.1| predicted protein [Leptosphaeria maculans JN3] gi|312217657|emb|CBX97604.1| predicted protein [Leptosphaeria maculans JN3] Length = 160 Score = 65.5 bits (158), Expect = 7e-09 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = -2 Query: 212 YTHYKPGFGAILLGTWIASVFGLCGVVSMFYPDKPSVPKTY 90 Y H+ PG+GA+L+GT+IASV GLCG VSM YPDK S P+T+ Sbjct: 96 YNHFTPGWGAVLMGTFIASVLGLCGAVSMVYPDKISAPRTF 136 >ref|XP_003305111.1| hypothetical protein PTT_17858 [Pyrenophora teres f. teres 0-1] gi|311318057|gb|EFQ86824.1| hypothetical protein PTT_17858 [Pyrenophora teres f. teres 0-1] Length = 159 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = -2 Query: 212 YTHYKPGFGAILLGTWIASVFGLCGVVSMFYPDKPSVPKTY 90 Y H+ PG+GA+LLG +A+VFGLC VS YPDK SVPKTY Sbjct: 96 YNHFTPGWGAVLLGISVATVFGLCAAVSTIYPDKISVPKTY 136 >ref|XP_001935129.1| NADH:ubiquinone oxidoreductase 20.1kD subunit [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187981077|gb|EDU47703.1| NADH:ubiquinone oxidoreductase 20.1kD subunit [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 213 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = -2 Query: 212 YTHYKPGFGAILLGTWIASVFGLCGVVSMFYPDKPSVPKTY 90 Y H+ PG+GA+LLG +A+VFGLC VS YPDK SVPKTY Sbjct: 150 YNHFTPGWGAVLLGISVATVFGLCAAVSTVYPDKISVPKTY 190 >gb|EON67091.1| NADH dehydrogenase (ubiquinone) 1 beta subcomplex 8 [Coniosporium apollinis CBS 100218] Length = 156 Score = 60.8 bits (146), Expect = 2e-07 Identities = 23/39 (58%), Positives = 33/39 (84%) Frame = -2 Query: 206 HYKPGFGAILLGTWIASVFGLCGVVSMFYPDKPSVPKTY 90 H+ PG+GA+LLGT++ASV GLC +V +YPDKP+VP+ + Sbjct: 92 HFTPGWGAVLLGTFVASVLGLCAIVLPYYPDKPAVPRAF 130 >gb|EMF14393.1| hypothetical protein SEPMUDRAFT_148112 [Sphaerulina musiva SO2202] Length = 189 Score = 60.5 bits (145), Expect = 2e-07 Identities = 24/41 (58%), Positives = 34/41 (82%) Frame = -2 Query: 212 YTHYKPGFGAILLGTWIASVFGLCGVVSMFYPDKPSVPKTY 90 YTH+ PG+GA+LLGT++ +V LCGVV +YPD+PSV +T+ Sbjct: 117 YTHFTPGWGAVLLGTFVGAVGVLCGVVYQYYPDRPSVSRTF 157 >ref|XP_003853010.1| hypothetical protein MYCGRDRAFT_104178 [Zymoseptoria tritici IPO323] gi|339472892|gb|EGP87986.1| hypothetical protein MYCGRDRAFT_104178 [Zymoseptoria tritici IPO323] Length = 183 Score = 60.1 bits (144), Expect = 3e-07 Identities = 24/41 (58%), Positives = 34/41 (82%) Frame = -2 Query: 212 YTHYKPGFGAILLGTWIASVFGLCGVVSMFYPDKPSVPKTY 90 YTH+KPG+G +LLG++I +V LC VV ++YPDKPSV +T+ Sbjct: 114 YTHFKPGWGGVLLGSFIGAVGALCVVVGIYYPDKPSVTRTF 154 >gb|EUC27106.1| hypothetical protein COCCADRAFT_112558 [Bipolaris zeicola 26-R-13] gi|578484630|gb|EUN22148.1| hypothetical protein COCVIDRAFT_112138 [Bipolaris victoriae FI3] Length = 161 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/41 (60%), Positives = 31/41 (75%) Frame = -2 Query: 212 YTHYKPGFGAILLGTWIASVFGLCGVVSMFYPDKPSVPKTY 90 Y H+ P +G +L+GT+IA+VFGLC V YPDK SVPKTY Sbjct: 98 YNHFSPQWGFVLMGTFIATVFGLCAAVKSVYPDKISVPKTY 138 >dbj|GAD99645.1| conserved hypothetical protein [Byssochlamys spectabilis No. 5] Length = 1507 Score = 59.7 bits (143), Expect = 4e-07 Identities = 23/41 (56%), Positives = 32/41 (78%) Frame = -2 Query: 212 YTHYKPGFGAILLGTWIASVFGLCGVVSMFYPDKPSVPKTY 90 YTH PG + +GT++A+ G CGVVS++YPDKPSVP+T+ Sbjct: 90 YTHVTPGKALLSIGTFVAAFLGFCGVVSLYYPDKPSVPRTF 130 >dbj|GAA91110.1| NADH:ubiquinone oxidoreductase kD subunit [Aspergillus kawachii IFO 4308] Length = 154 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/41 (60%), Positives = 30/41 (73%) Frame = -2 Query: 212 YTHYKPGFGAILLGTWIASVFGLCGVVSMFYPDKPSVPKTY 90 YTH G + +G ++ + GLCGVVSMFYPDKPSVPKTY Sbjct: 90 YTHVTARKGLLQVGAFVVTFLGLCGVVSMFYPDKPSVPKTY 130 >ref|XP_001262872.1| hypothetical protein NFIA_115110 [Neosartorya fischeri NRRL 181] gi|119411030|gb|EAW20975.1| conserved hypothetical protein [Neosartorya fischeri NRRL 181] Length = 154 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/65 (44%), Positives = 34/65 (52%) Frame = -2 Query: 212 YTHYKPGFGAILLGTWIASVFGLCGVVSMFYPDKPSVPKTYXXXXXXXXXXXXXXXXXXX 33 YTH P G +G +IA+ LCGVVS++YPDKPSVPKTY Sbjct: 90 YTHVTPRKGLFQIGAFIATFLTLCGVVSLYYPDKPSVPKTYPGGLEKELGGASAVPARKA 149 Query: 32 GEDKW 18 GED W Sbjct: 150 GEDSW 154 >gb|EUC40227.1| hypothetical protein COCMIDRAFT_109337 [Bipolaris oryzae ATCC 44560] Length = 161 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/41 (58%), Positives = 30/41 (73%) Frame = -2 Query: 212 YTHYKPGFGAILLGTWIASVFGLCGVVSMFYPDKPSVPKTY 90 Y H+ P +G +L+GT+IA+VFGLC V YPDK S PKTY Sbjct: 98 YNHFSPQWGFVLMGTFIATVFGLCAAVKSVYPDKISAPKTY 138 >gb|EOA91257.1| hypothetical protein SETTUDRAFT_162030 [Setosphaeria turcica Et28A] Length = 161 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/41 (60%), Positives = 30/41 (73%) Frame = -2 Query: 212 YTHYKPGFGAILLGTWIASVFGLCGVVSMFYPDKPSVPKTY 90 Y H+ P +G +LLGT++ASV GLC V YPDK SVPKTY Sbjct: 98 YNHFTPQWGFVLLGTFVASVVGLCAAVKSVYPDKISVPKTY 138 >gb|EMD85505.1| hypothetical protein COCHEDRAFT_1024438 [Bipolaris maydis C5] gi|477582935|gb|ENI00039.1| hypothetical protein COCC4DRAFT_34607 [Bipolaris maydis ATCC 48331] Length = 161 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/41 (58%), Positives = 30/41 (73%) Frame = -2 Query: 212 YTHYKPGFGAILLGTWIASVFGLCGVVSMFYPDKPSVPKTY 90 Y H+ P +G +L+GT+IA+VFGLC V YPDK S PKTY Sbjct: 98 YNHFSPQWGFVLMGTFIATVFGLCAAVKSVYPDKISAPKTY 138 >gb|EMD59500.1| hypothetical protein COCSADRAFT_40696 [Bipolaris sorokiniana ND90Pr] Length = 161 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/41 (58%), Positives = 30/41 (73%) Frame = -2 Query: 212 YTHYKPGFGAILLGTWIASVFGLCGVVSMFYPDKPSVPKTY 90 Y H+ P +G +L+GT+IA+VFGLC V YPDK S PKTY Sbjct: 98 YNHFSPQWGFVLMGTFIATVFGLCAAVKSVYPDKISAPKTY 138 >ref|XP_001584814.1| hypothetical protein SS1G_14269 [Sclerotinia sclerotiorum 1980] gi|154700660|gb|EDO00399.1| hypothetical protein SS1G_14269 [Sclerotinia sclerotiorum 1980 UF-70] Length = 171 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/41 (60%), Positives = 30/41 (73%) Frame = -2 Query: 212 YTHYKPGFGAILLGTWIASVFGLCGVVSMFYPDKPSVPKTY 90 YTH KPG A+ LG ++ SVFGLC VV M YPDK SVP+ + Sbjct: 108 YTHQKPGTAALQLGVFVLSVFGLCTVVGMMYPDKQSVPREF 148 >gb|EME46654.1| hypothetical protein DOTSEDRAFT_126442 [Dothistroma septosporum NZE10] Length = 191 Score = 57.8 bits (138), Expect = 2e-06 Identities = 23/41 (56%), Positives = 33/41 (80%) Frame = -2 Query: 212 YTHYKPGFGAILLGTWIASVFGLCGVVSMFYPDKPSVPKTY 90 YTH+KP +G +LLGT++A+V LC VV +YPD+PSV +T+ Sbjct: 120 YTHFKPAWGGVLLGTFVATVGVLCAVVYRYYPDRPSVTRTF 160 >gb|EEH10848.1| NADH-ubiquinone oxidoreductase [Ajellomyces capsulatus G186AR] gi|240281001|gb|EER44504.1| NADH-ubiquinone oxidoreductase kD subunit [Ajellomyces capsulatus H143] gi|325092505|gb|EGC45815.1| NADH-ubiquinone oxidoreductase [Ajellomyces capsulatus H88] Length = 156 Score = 57.8 bits (138), Expect = 2e-06 Identities = 31/65 (47%), Positives = 35/65 (53%) Frame = -2 Query: 212 YTHYKPGFGAILLGTWIASVFGLCGVVSMFYPDKPSVPKTYXXXXXXXXXXXXXXXXXXX 33 YTH+KP G +LLG SV L GVVSMFYPDKPS P+T+ Sbjct: 92 YTHFKPAKGFLLLGCAGGSVLLLSGVVSMFYPDKPSSPRTFEGGLERELGGPNAVRARAP 151 Query: 32 GEDKW 18 GEDKW Sbjct: 152 GEDKW 156 >ref|XP_001540554.1| conserved hypothetical protein [Ajellomyces capsulatus NAm1] gi|150412497|gb|EDN07884.1| conserved hypothetical protein [Ajellomyces capsulatus NAm1] Length = 156 Score = 57.8 bits (138), Expect = 2e-06 Identities = 31/65 (47%), Positives = 35/65 (53%) Frame = -2 Query: 212 YTHYKPGFGAILLGTWIASVFGLCGVVSMFYPDKPSVPKTYXXXXXXXXXXXXXXXXXXX 33 YTH+KP G +LLG SV L GVVSMFYPDKPS P+T+ Sbjct: 92 YTHFKPAKGFLLLGCAGGSVLLLSGVVSMFYPDKPSSPRTFEGGLERELGGPNAVRARAP 151 Query: 32 GEDKW 18 GEDKW Sbjct: 152 GEDKW 156 >ref|XP_001395111.1| NADH:ubiquinone oxidoreductase kD subunit [Aspergillus niger CBS 513.88] gi|134079818|emb|CAK40952.1| unnamed protein product [Aspergillus niger] gi|350637631|gb|EHA25988.1| hypothetical protein ASPNIDRAFT_54443 [Aspergillus niger ATCC 1015] Length = 154 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/41 (60%), Positives = 29/41 (70%) Frame = -2 Query: 212 YTHYKPGFGAILLGTWIASVFGLCGVVSMFYPDKPSVPKTY 90 YTH G +G ++ + GLCGVVSMFYPDKPSVPKTY Sbjct: 90 YTHVTARKGLFQVGAFVVTFLGLCGVVSMFYPDKPSVPKTY 130