BLASTX nr result
ID: Akebia25_contig00064753
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00064753 (359 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN83285.1| hypothetical protein VITISV_004139 [Vitis vinifera] 56 6e-06 emb|CAN60203.1| hypothetical protein VITISV_036059 [Vitis vinifera] 56 6e-06 >emb|CAN83285.1| hypothetical protein VITISV_004139 [Vitis vinifera] Length = 1556 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/48 (47%), Positives = 36/48 (75%) Frame = +2 Query: 125 FIAWRRSD*LLCGWITGSLSEGIFGMVVGFEIASEVWDTLINSLSQES 268 +IAWR++D LL GWI G+LSE G+ VG + A++VW+ L N+ +++S Sbjct: 333 YIAWRKADRLLRGWIIGTLSEETLGLAVGLDTANDVWEALKNAYAEDS 380 >emb|CAN60203.1| hypothetical protein VITISV_036059 [Vitis vinifera] Length = 1412 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/48 (47%), Positives = 36/48 (75%) Frame = +2 Query: 125 FIAWRRSD*LLCGWITGSLSEGIFGMVVGFEIASEVWDTLINSLSQES 268 +IAWR++D LL GWI G+LSE G+ VG + A++VW+ L N+ +++S Sbjct: 73 YIAWRKADRLLRGWIIGTLSEETLGLAVGLDTANDVWEALKNAYAEDS 120