BLASTX nr result
ID: Akebia25_contig00064433
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00064433 (287 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ELR08411.1| hypothetical protein GMDG_03200 [Pseudogymnoascus... 105 5e-21 ref|XP_001393812.1| hypothetical protein ANI_1_1438084 [Aspergil... 95 1e-17 gb|EPS34001.1| hypothetical protein PDE_08963 [Penicillium oxali... 78 1e-12 gb|EFW15376.1| predicted protein [Coccidioides posadasii str. Si... 68 1e-09 emb|CDM38415.1| BTB/POZ fold [Penicillium roqueforti] 67 3e-09 ref|XP_007294037.1| BTB/POZ domain containing protein [Marssonin... 64 2e-08 ref|XP_007290746.1| hypothetical protein MBM_02857 [Marssonina b... 58 2e-06 >gb|ELR08411.1| hypothetical protein GMDG_03200 [Pseudogymnoascus destructans 20631-21] Length = 191 Score = 105 bits (263), Expect = 5e-21 Identities = 57/87 (65%), Positives = 64/87 (73%) Frame = -3 Query: 261 ADPVLDRPFGVFVESSLPLYSGPQVTIRIAPTNREYKLSKALLCKHSPAFKATFEGNFRE 82 A VLD F F S LPLYS P VTIRIA + EYKL KALLCK SP F ATF G+FRE Sbjct: 17 AKGVLDATFEHFATSLLPLYSDPLVTIRIA--SHEYKLPKALLCKQSPYFAATFNGSFRE 74 Query: 81 GQEQATTLEEEDGVVSTQSFDLLVQWI 1 G++Q+T LEE DGVVS +SF +LVQWI Sbjct: 75 GEKQSTNLEEIDGVVSIRSFQMLVQWI 101 >ref|XP_001393812.1| hypothetical protein ANI_1_1438084 [Aspergillus niger CBS 513.88] gi|134078361|emb|CAK40353.1| unnamed protein product [Aspergillus niger] gi|350640116|gb|EHA28469.1| hypothetical protein ASPNIDRAFT_43222 [Aspergillus niger ATCC 1015] Length = 241 Score = 94.7 bits (234), Expect = 1e-17 Identities = 41/83 (49%), Positives = 61/83 (73%) Frame = -3 Query: 249 LDRPFGVFVESSLPLYSGPQVTIRIAPTNREYKLSKALLCKHSPAFKATFEGNFREGQEQ 70 LD P F+ES LPL++GP VT+++ R+YK+S+ LLCKHSP F+A FE ++E EQ Sbjct: 9 LDMPDDNFIESLLPLHNGPYVTLQVGSEGRKYKVSRPLLCKHSPYFRAMFESGYKESHEQ 68 Query: 69 ATTLEEEDGVVSTQSFDLLVQWI 1 A T+ E +GVV+ +S ++L+QW+ Sbjct: 69 AVTMHEIEGVVTERSLEMLLQWL 91 >gb|EPS34001.1| hypothetical protein PDE_08963 [Penicillium oxalicum 114-2] Length = 241 Score = 77.8 bits (190), Expect = 1e-12 Identities = 40/83 (48%), Positives = 51/83 (61%) Frame = -3 Query: 249 LDRPFGVFVESSLPLYSGPQVTIRIAPTNREYKLSKALLCKHSPAFKATFEGNFREGQEQ 70 LD + V LPLY+GP +RI ++ EY +SK LLC+ S FKA FEG F E EQ Sbjct: 5 LDIDVEIMVTKILPLYNGPFAKLRIKSSDVEYTVSKPLLCQESAYFKAMFEGEFSEDAEQ 64 Query: 69 ATTLEEEDGVVSTQSFDLLVQWI 1 TLE +GV+S +S L+QWI Sbjct: 65 IATLEPVEGVLSVRSVQCLLQWI 87 >gb|EFW15376.1| predicted protein [Coccidioides posadasii str. Silveira] Length = 174 Score = 67.8 bits (164), Expect = 1e-09 Identities = 33/61 (54%), Positives = 41/61 (67%) Frame = -3 Query: 183 IRIAPTNREYKLSKALLCKHSPAFKATFEGNFREGQEQATTLEEEDGVVSTQSFDLLVQW 4 I+I PT Y +SK LLC SP F F G F+EGQEQ+ LEE +GVVS +SF L +QW Sbjct: 35 IKIGPT--AYDVSKTLLCSRSPYFAGMFNGKFKEGQEQSAVLEEIEGVVSNRSFRLFLQW 92 Query: 3 I 1 + Sbjct: 93 L 93 >emb|CDM38415.1| BTB/POZ fold [Penicillium roqueforti] Length = 219 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/72 (43%), Positives = 48/72 (66%), Gaps = 1/72 (1%) Frame = -3 Query: 213 LPLYSGPQVTIRIAPTNREYKLSKALLCKHSPAFKATFE-GNFREGQEQATTLEEEDGVV 37 LPLY P + IR+ ++ E +S+ LLC SP F F+ G+F+E Q+QA LEE DG++ Sbjct: 2 LPLYHEPTIKIRVKTSDAEIAISRDLLCAKSPVFTKMFKNGHFKESQDQALDLEEMDGII 61 Query: 36 STQSFDLLVQWI 1 S ++ + L+QW+ Sbjct: 62 SNRALEGLLQWL 73 >ref|XP_007294037.1| BTB/POZ domain containing protein [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406862470|gb|EKD15520.1| BTB/POZ domain containing protein [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 328 Score = 64.3 bits (155), Expect = 2e-08 Identities = 34/71 (47%), Positives = 46/71 (64%) Frame = -3 Query: 213 LPLYSGPQVTIRIAPTNREYKLSKALLCKHSPAFKATFEGNFREGQEQATTLEEEDGVVS 34 + L+ GPQV+I IA R++KL KAL C SP F A F NF+EG+EQ TL + S Sbjct: 36 IQLFQGPQVSIVIA--ERDFKLPKALACYSSPYFNAAFNSNFKEGEEQKLTLTD----CS 89 Query: 33 TQSFDLLVQWI 1 ++F L+VQW+ Sbjct: 90 PETFSLVVQWM 100 >ref|XP_007290746.1| hypothetical protein MBM_02857 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406865574|gb|EKD18615.1| hypothetical protein MBM_02857 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 231 Score = 57.8 bits (138), Expect = 2e-06 Identities = 30/88 (34%), Positives = 47/88 (53%) Frame = -3 Query: 264 MADPVLDRPFGVFVESSLPLYSGPQVTIRIAPTNREYKLSKALLCKHSPAFKATFEGNFR 85 MA P + PFG + + + +T+ PT R +K+ L+C P FKA F+GNF+ Sbjct: 5 MATPSIQAPFGQILGTDIAT-----ITVGSGPTARTFKVHTDLICSKVPFFKAMFKGNFK 59 Query: 84 EGQEQATTLEEEDGVVSTQSFDLLVQWI 1 E Q TL E+D + +F+L + W+ Sbjct: 60 EAATQTATLPEDDPL----AFELFLGWV 83