BLASTX nr result
ID: Akebia25_contig00064318
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00064318 (292 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME40982.1| hypothetical protein DOTSEDRAFT_74511 [Dothistrom... 55 8e-07 >gb|EME40982.1| hypothetical protein DOTSEDRAFT_74511 [Dothistroma septosporum NZE10] Length = 289 Score = 55.1 bits (131), Expect(2) = 8e-07 Identities = 30/57 (52%), Positives = 37/57 (64%), Gaps = 1/57 (1%) Frame = -1 Query: 283 HDSK-DVDRRLAQEASQFKDTTQHVKGEHTQSAAPXXXXXXXXXXXXETIQPVVNKQ 116 H +K DVDR+L + A QF+DT+Q V+G+HT S AP ETIQPVVNKQ Sbjct: 87 HGNKGDVDRKLNETAGQFRDTSQRVEGQHTTSNAPAIGGEHIHHHVHETIQPVVNKQ 143 Score = 23.5 bits (49), Expect(2) = 8e-07 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -2 Query: 30 LPAVSMADFK 1 LPAVSMADFK Sbjct: 172 LPAVSMADFK 181