BLASTX nr result
ID: Akebia25_contig00064051
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00064051 (319 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ETN40271.1| 60S ribosomal protein L39 [Cyphellophora europaea... 83 4e-14 gb|EMF12058.1| ribosomal protein L39e [Sphaerulina musiva SO2202] 83 4e-14 gb|EME82094.1| hypothetical protein MYCFIDRAFT_30141, partial [P... 83 4e-14 gb|EME43136.1| hypothetical protein DOTSEDRAFT_173805 [Dothistro... 83 4e-14 ref|XP_003850033.1| 60S ribosomal protein L39 [Zymoseptoria trit... 83 4e-14 ref|XP_387097.1| hypothetical protein FG06921.1 [Fusarium gramin... 82 6e-14 emb|CCT65955.1| probable RPL39-60S large subunit ribosomal prote... 82 6e-14 gb|EMT65472.1| 60S ribosomal protein L39, partial [Fusarium oxys... 82 6e-14 ref|XP_003051759.1| 60S ribosomal protein L39 [Nectria haematoco... 82 6e-14 emb|CCX04754.1| Protein of unknown function [Pyronema omphalodes... 82 8e-14 gb|EQB47836.1| hypothetical protein CGLO_12990 [Colletotrichum g... 82 8e-14 gb|EPS27305.1| hypothetical protein PDE_02248 [Penicillium oxali... 82 8e-14 gb|ENI02547.1| hypothetical protein COCC4DRAFT_145443, partial [... 82 8e-14 gb|ENH81096.1| 60s ribosomal protein l39 [Colletotrichum orbicul... 82 8e-14 gb|EMC96913.1| hypothetical protein BAUCODRAFT_147112 [Baudoinia... 82 8e-14 gb|EGD93107.1| hypothetical protein TESG_00663 [Trichophyton ton... 82 8e-14 ref|XP_002848813.1| hypothetical protein MCYG_01747 [Arthroderma... 82 8e-14 ref|XP_002544670.1| predicted protein [Uncinocarpus reesii 1704]... 82 8e-14 ref|XP_002482271.1| ribosomal protein L39e, putative [Talaromyce... 82 8e-14 ref|XP_001542836.1| 60S ribosomal protein L39 [Ajellomyces capsu... 82 8e-14 >gb|ETN40271.1| 60S ribosomal protein L39 [Cyphellophora europaea CBS 101466] Length = 72 Score = 82.8 bits (203), Expect = 4e-14 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -3 Query: 317 KAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 207 KAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI Sbjct: 36 KAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 72 >gb|EMF12058.1| ribosomal protein L39e [Sphaerulina musiva SO2202] Length = 51 Score = 82.8 bits (203), Expect = 4e-14 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -3 Query: 317 KAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 207 KAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI Sbjct: 15 KAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 51 >gb|EME82094.1| hypothetical protein MYCFIDRAFT_30141, partial [Pseudocercospora fijiensis CIRAD86] Length = 49 Score = 82.8 bits (203), Expect = 4e-14 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -3 Query: 317 KAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 207 KAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI Sbjct: 13 KAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 49 >gb|EME43136.1| hypothetical protein DOTSEDRAFT_173805 [Dothistroma septosporum NZE10] Length = 51 Score = 82.8 bits (203), Expect = 4e-14 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -3 Query: 317 KAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 207 KAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI Sbjct: 15 KAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 51 >ref|XP_003850033.1| 60S ribosomal protein L39 [Zymoseptoria tritici IPO323] gi|339469911|gb|EGP85009.1| hypothetical protein MYCGRDRAFT_105463 [Zymoseptoria tritici IPO323] gi|494829312|gb|EON66003.1| 60S ribosomal protein L39 [Coniosporium apollinis CBS 100218] Length = 51 Score = 82.8 bits (203), Expect = 4e-14 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -3 Query: 317 KAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 207 KAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI Sbjct: 15 KAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 51 >ref|XP_387097.1| hypothetical protein FG06921.1 [Fusarium graminearum PH-1] Length = 50 Score = 82.4 bits (202), Expect = 6e-14 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -3 Query: 317 KAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 207 KAQKQNRP+PQWIRLRTGNTIRYNAKRRHWRKTRIGI Sbjct: 14 KAQKQNRPVPQWIRLRTGNTIRYNAKRRHWRKTRIGI 50 >emb|CCT65955.1| probable RPL39-60S large subunit ribosomal protein L39.e [Fusarium fujikuroi IMI 58289] Length = 93 Score = 82.4 bits (202), Expect = 6e-14 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -3 Query: 317 KAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 207 KAQKQNRP+PQWIRLRTGNTIRYNAKRRHWRKTRIGI Sbjct: 57 KAQKQNRPVPQWIRLRTGNTIRYNAKRRHWRKTRIGI 93 >gb|EMT65472.1| 60S ribosomal protein L39, partial [Fusarium oxysporum f. sp. cubense race 4] gi|477512034|gb|ENH64595.1| 60S ribosomal protein L39, partial [Fusarium oxysporum f. sp. cubense race 1] Length = 49 Score = 82.4 bits (202), Expect = 6e-14 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -3 Query: 317 KAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 207 KAQKQNRP+PQWIRLRTGNTIRYNAKRRHWRKTRIGI Sbjct: 13 KAQKQNRPVPQWIRLRTGNTIRYNAKRRHWRKTRIGI 49 >ref|XP_003051759.1| 60S ribosomal protein L39 [Nectria haematococca mpVI 77-13-4] gi|256732698|gb|EEU46046.1| predicted protein [Nectria haematococca mpVI 77-13-4] gi|342865967|gb|EGU71968.1| hypothetical protein FOXB_17529 [Fusarium oxysporum Fo5176] gi|408388242|gb|EKJ67928.1| hypothetical protein FPSE_11739 [Fusarium pseudograminearum CS3096] gi|558862998|gb|ESU13081.1| hypothetical protein FGSG_06921 [Fusarium graminearum PH-1] gi|584139211|gb|EWG48551.1| 60S ribosomal protein L39 [Fusarium verticillioides 7600] gi|587676271|gb|EWY98599.1| 60S ribosomal protein L39 [Fusarium oxysporum FOSC 3-a] gi|587698070|gb|EWZ44675.1| 60S ribosomal protein L39 [Fusarium oxysporum Fo47] gi|587727111|gb|EWZ98448.1| 60S ribosomal protein L39 [Fusarium oxysporum f. sp. lycopersici MN25] gi|587752242|gb|EXA49958.1| 60S ribosomal protein L39 [Fusarium oxysporum f. sp. pisi HDV247] gi|590040183|gb|EXK42041.1| 60S ribosomal protein L39 [Fusarium oxysporum f. sp. melonis 26406] gi|590073088|gb|EXL00613.1| 60S ribosomal protein L39 [Fusarium oxysporum f. sp. raphani 54005] gi|591426865|gb|EXL62002.1| 60S ribosomal protein L39 [Fusarium oxysporum f. sp. radicis-lycopersici 26381] gi|591453858|gb|EXL86129.1| 60S ribosomal protein L39 [Fusarium oxysporum f. sp. conglutinans race 2 54008] gi|591463667|gb|EXL95148.1| 60S ribosomal protein L39 [Fusarium oxysporum f. sp. cubense tropical race 4 54006] gi|591507348|gb|EXM36611.1| 60S ribosomal protein L39 [Fusarium oxysporum f. sp. vasinfectum 25433] gi|596543402|gb|EYB23707.1| hypothetical protein FG05_06921 [Fusarium graminearum] Length = 51 Score = 82.4 bits (202), Expect = 6e-14 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -3 Query: 317 KAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 207 KAQKQNRP+PQWIRLRTGNTIRYNAKRRHWRKTRIGI Sbjct: 15 KAQKQNRPVPQWIRLRTGNTIRYNAKRRHWRKTRIGI 51 >emb|CCX04754.1| Protein of unknown function [Pyronema omphalodes CBS 100304] Length = 51 Score = 82.0 bits (201), Expect = 8e-14 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -3 Query: 317 KAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 207 KAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTR+GI Sbjct: 15 KAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 51 >gb|EQB47836.1| hypothetical protein CGLO_12990 [Colletotrichum gloeosporioides Cg-14] Length = 97 Score = 82.0 bits (201), Expect = 8e-14 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -3 Query: 317 KAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 207 KAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTR+GI Sbjct: 61 KAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 97 >gb|EPS27305.1| hypothetical protein PDE_02248 [Penicillium oxalicum 114-2] Length = 51 Score = 82.0 bits (201), Expect = 8e-14 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -3 Query: 317 KAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 207 KAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTR+GI Sbjct: 15 KAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 51 >gb|ENI02547.1| hypothetical protein COCC4DRAFT_145443, partial [Bipolaris maydis ATCC 48331] Length = 51 Score = 82.0 bits (201), Expect = 8e-14 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -3 Query: 317 KAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 207 KAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTR+GI Sbjct: 15 KAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 51 >gb|ENH81096.1| 60s ribosomal protein l39 [Colletotrichum orbiculare MAFF 240422] Length = 77 Score = 82.0 bits (201), Expect = 8e-14 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -3 Query: 317 KAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 207 KAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTR+GI Sbjct: 41 KAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 77 >gb|EMC96913.1| hypothetical protein BAUCODRAFT_147112 [Baudoinia compniacensis UAMH 10762] Length = 51 Score = 82.0 bits (201), Expect = 8e-14 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -3 Query: 317 KAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 207 KAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIG+ Sbjct: 15 KAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGL 51 >gb|EGD93107.1| hypothetical protein TESG_00663 [Trichophyton tonsurans CBS 112818] Length = 118 Score = 82.0 bits (201), Expect = 8e-14 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -3 Query: 317 KAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 207 KAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTR+GI Sbjct: 82 KAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 118 >ref|XP_002848813.1| hypothetical protein MCYG_01747 [Arthroderma otae CBS 113480] gi|238839266|gb|EEQ28928.1| hypothetical protein MCYG_01747 [Arthroderma otae CBS 113480] Length = 94 Score = 82.0 bits (201), Expect = 8e-14 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -3 Query: 317 KAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 207 KAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTR+GI Sbjct: 58 KAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 94 >ref|XP_002544670.1| predicted protein [Uncinocarpus reesii 1704] gi|237904940|gb|EEP79341.1| predicted protein [Uncinocarpus reesii 1704] Length = 183 Score = 82.0 bits (201), Expect = 8e-14 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -3 Query: 317 KAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 207 KAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTR+GI Sbjct: 147 KAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 183 >ref|XP_002482271.1| ribosomal protein L39e, putative [Talaromyces stipitatus ATCC 10500] gi|218718859|gb|EED18279.1| ribosomal protein L39e, putative [Talaromyces stipitatus ATCC 10500] Length = 109 Score = 82.0 bits (201), Expect = 8e-14 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -3 Query: 317 KAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 207 KAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTR+GI Sbjct: 73 KAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 109 >ref|XP_001542836.1| 60S ribosomal protein L39 [Ajellomyces capsulatus NAm1] gi|327292414|ref|XP_003230906.1| 60S ribosomal protein L39 [Trichophyton rubrum CBS 118892] gi|389629646|ref|XP_003712476.1| 60S ribosomal protein L39 [Magnaporthe oryzae 70-15] gi|615467304|ref|XP_007599880.1| hypothetical protein CFIO01_13564 [Colletotrichum fioriniae PJ7] gi|150411016|gb|EDN06404.1| ribosomal protein L39 [Ajellomyces capsulatus NAm1] gi|259487695|tpe|CBF86564.1| TPA: conserved hypothetical protein [Aspergillus nidulans FGSC A4] gi|326466942|gb|EGD92395.1| ribosomal L39 protein [Trichophyton rubrum CBS 118892] gi|351644808|gb|EHA52669.1| 60S ribosomal protein L39 [Magnaporthe oryzae 70-15] gi|402083766|gb|EJT78784.1| 60S ribosomal protein L39 [Gaeumannomyces graminis var. tritici R3-111a-1] gi|440475962|gb|ELQ44608.1| hypothetical protein OOU_Y34scaffold00071g24 [Magnaporthe oryzae Y34] gi|440487781|gb|ELQ67556.1| hypothetical protein OOW_P131scaffold00314g129 [Magnaporthe oryzae P131] gi|482812667|gb|EOA89386.1| hypothetical protein SETTUDRAFT_46231 [Setosphaeria turcica Et28A] gi|550808028|gb|ERS99941.1| 60S ribosomal protein L39 [Sporothrix schenckii ATCC 58251] gi|588894534|gb|EXF76478.1| hypothetical protein CFIO01_13564 [Colletotrichum fioriniae PJ7] gi|607883430|gb|EZF28033.1| 60S ribosomal protein L39 [Trichophyton rubrum MR850] gi|607910227|gb|EZF47097.1| 60S ribosomal protein L39 [Trichophyton rubrum CBS 100081] gi|607922284|gb|EZF57748.1| 60S ribosomal protein L39 [Trichophyton rubrum CBS 288.86] gi|607934286|gb|EZF68319.1| 60S ribosomal protein L39 [Trichophyton rubrum CBS 289.86] gi|607946260|gb|EZF79023.1| 60S ribosomal protein L39 [Trichophyton soudanense CBS 452.61] gi|607958340|gb|EZF89637.1| 60S ribosomal protein L39 [Trichophyton rubrum MR1448] gi|607970581|gb|EZG00476.1| 60S ribosomal protein L39 [Trichophyton rubrum MR1459] gi|607976489|gb|EZG05683.1| 60S ribosomal protein L39 [Trichophyton rubrum CBS 735.88] gi|607994655|gb|EZG22078.1| 60S ribosomal protein L39 [Trichophyton rubrum CBS 202.88] Length = 51 Score = 82.0 bits (201), Expect = 8e-14 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -3 Query: 317 KAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 207 KAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTR+GI Sbjct: 15 KAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 51