BLASTX nr result
ID: Akebia25_contig00064049
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00064049 (269 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME44853.1| hypothetical protein DOTSEDRAFT_70793 [Dothistrom... 57 3e-06 >gb|EME44853.1| hypothetical protein DOTSEDRAFT_70793 [Dothistroma septosporum NZE10] Length = 875 Score = 57.0 bits (136), Expect = 3e-06 Identities = 36/93 (38%), Positives = 52/93 (55%), Gaps = 11/93 (11%) Frame = -1 Query: 248 ASLIP-DWQYTYE---APNQLPSYGSSASDNSYD-----TTGFGGPLQTSPVDYLP--SA 102 A+++P DWQY + Q YG + N++D T FG LQ+SP+D++P +A Sbjct: 163 ANMLPSDWQYQLQHAAQQQQQQQYGGAQDSNAFDVNAFNTASFGAQLQSSPIDFMPVTTA 222 Query: 101 GPEMQLPMHVSSSTMPVTQYLSMAGPMESMGAL 3 G + S+ M T Y++MAGPMESM AL Sbjct: 223 GG------YSVSTGMESTNYMTMAGPMESMNAL 249