BLASTX nr result
ID: Akebia25_contig00063880
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00063880 (364 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006489841.1| PREDICTED: probable methionine--tRNA ligase-... 56 5e-06 ref|XP_006420966.1| hypothetical protein CICLE_v10004343mg [Citr... 56 5e-06 ref|XP_006420965.1| hypothetical protein CICLE_v10004343mg [Citr... 56 5e-06 ref|XP_006420964.1| hypothetical protein CICLE_v10004343mg [Citr... 56 5e-06 ref|XP_007201730.1| hypothetical protein PRUPE_ppa002951mg [Prun... 56 5e-06 ref|XP_002518056.1| methionine-tRNA synthetase, putative [Ricinu... 56 5e-06 ref|XP_002521069.1| methionine-tRNA synthetase, putative [Ricinu... 56 5e-06 gb|EYU22244.1| hypothetical protein MIMGU_mgv1a001483mg [Mimulus... 56 6e-06 ref|XP_002298685.1| methionyl-tRNA synthetase family protein [Po... 56 6e-06 gb|EXB50508.1| putative methionine--tRNA ligase [Morus notabilis] 55 8e-06 ref|XP_006495241.1| PREDICTED: probable methionine--tRNA ligase-... 55 8e-06 ref|XP_006361630.1| PREDICTED: probable methionine--tRNA ligase-... 55 8e-06 >ref|XP_006489841.1| PREDICTED: probable methionine--tRNA ligase-like [Citrus sinensis] Length = 809 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/36 (69%), Positives = 28/36 (77%) Frame = +2 Query: 257 CSTCVSCSCRYYTIHKEVYKWFDISFDEFGRTSTPQ 364 CS C +Y+ IHK+VYKWFDISFD FGRTSTPQ Sbjct: 87 CSPKEICD-KYHVIHKDVYKWFDISFDNFGRTSTPQ 121 >ref|XP_006420966.1| hypothetical protein CICLE_v10004343mg [Citrus clementina] gi|557522839|gb|ESR34206.1| hypothetical protein CICLE_v10004343mg [Citrus clementina] Length = 744 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/36 (69%), Positives = 28/36 (77%) Frame = +2 Query: 257 CSTCVSCSCRYYTIHKEVYKWFDISFDEFGRTSTPQ 364 CS C +Y+ IHK+VYKWFDISFD FGRTSTPQ Sbjct: 85 CSPKEICD-KYHVIHKDVYKWFDISFDNFGRTSTPQ 119 >ref|XP_006420965.1| hypothetical protein CICLE_v10004343mg [Citrus clementina] gi|557522838|gb|ESR34205.1| hypothetical protein CICLE_v10004343mg [Citrus clementina] Length = 807 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/36 (69%), Positives = 28/36 (77%) Frame = +2 Query: 257 CSTCVSCSCRYYTIHKEVYKWFDISFDEFGRTSTPQ 364 CS C +Y+ IHK+VYKWFDISFD FGRTSTPQ Sbjct: 85 CSPKEICD-KYHVIHKDVYKWFDISFDNFGRTSTPQ 119 >ref|XP_006420964.1| hypothetical protein CICLE_v10004343mg [Citrus clementina] gi|557522837|gb|ESR34204.1| hypothetical protein CICLE_v10004343mg [Citrus clementina] Length = 808 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/36 (69%), Positives = 28/36 (77%) Frame = +2 Query: 257 CSTCVSCSCRYYTIHKEVYKWFDISFDEFGRTSTPQ 364 CS C +Y+ IHK+VYKWFDISFD FGRTSTPQ Sbjct: 85 CSPKEICD-KYHVIHKDVYKWFDISFDNFGRTSTPQ 119 >ref|XP_007201730.1| hypothetical protein PRUPE_ppa002951mg [Prunus persica] gi|462397130|gb|EMJ02929.1| hypothetical protein PRUPE_ppa002951mg [Prunus persica] Length = 618 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +2 Query: 284 RYYTIHKEVYKWFDISFDEFGRTSTPQ 364 +YY IHKEVY WFDI FDEFGRTSTPQ Sbjct: 94 KYYAIHKEVYDWFDICFDEFGRTSTPQ 120 >ref|XP_002518056.1| methionine-tRNA synthetase, putative [Ricinus communis] gi|223542652|gb|EEF44189.1| methionine-tRNA synthetase, putative [Ricinus communis] Length = 678 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = +2 Query: 257 CSTCVSCSCRYYTIHKEVYKWFDISFDEFGRTSTPQ 364 CS C +Y+ IH+EVYKWF+ISFDEFGRTSTPQ Sbjct: 88 CSPKEICD-KYHAIHREVYKWFNISFDEFGRTSTPQ 122 >ref|XP_002521069.1| methionine-tRNA synthetase, putative [Ricinus communis] gi|223539638|gb|EEF41220.1| methionine-tRNA synthetase, putative [Ricinus communis] Length = 617 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/27 (85%), Positives = 25/27 (92%) Frame = +2 Query: 284 RYYTIHKEVYKWFDISFDEFGRTSTPQ 364 +Y+ IHKEVY WFDISFDEFGRTSTPQ Sbjct: 93 KYHAIHKEVYDWFDISFDEFGRTSTPQ 119 >gb|EYU22244.1| hypothetical protein MIMGU_mgv1a001483mg [Mimulus guttatus] Length = 811 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = +2 Query: 257 CSTCVSCSCRYYTIHKEVYKWFDISFDEFGRTSTPQ 364 CS C +Y+ IHKEVYKWF+ISFDEFGRTS+PQ Sbjct: 87 CSPKEICD-KYHAIHKEVYKWFNISFDEFGRTSSPQ 121 >ref|XP_002298685.1| methionyl-tRNA synthetase family protein [Populus trichocarpa] gi|222845943|gb|EEE83490.1| methionyl-tRNA synthetase family protein [Populus trichocarpa] Length = 805 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/27 (81%), Positives = 26/27 (96%) Frame = +2 Query: 284 RYYTIHKEVYKWFDISFDEFGRTSTPQ 364 +YY IH+EVYKWF+ISFDEFGRTS+PQ Sbjct: 88 KYYAIHREVYKWFNISFDEFGRTSSPQ 114 >gb|EXB50508.1| putative methionine--tRNA ligase [Morus notabilis] Length = 770 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/36 (66%), Positives = 29/36 (80%) Frame = +2 Query: 257 CSTCVSCSCRYYTIHKEVYKWFDISFDEFGRTSTPQ 364 CST C +Y+ IH++VYKWF+ISFDEFGRTS PQ Sbjct: 88 CSTKEICD-KYHAIHRDVYKWFNISFDEFGRTSAPQ 122 >ref|XP_006495241.1| PREDICTED: probable methionine--tRNA ligase-like, partial [Citrus sinensis] Length = 281 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +2 Query: 284 RYYTIHKEVYKWFDISFDEFGRTSTPQ 364 RYY IHK VY WF+ISFDEFGRTSTPQ Sbjct: 2 RYYAIHKAVYNWFNISFDEFGRTSTPQ 28 >ref|XP_006361630.1| PREDICTED: probable methionine--tRNA ligase-like [Solanum tuberosum] Length = 812 Score = 55.5 bits (132), Expect = 8e-06 Identities = 22/27 (81%), Positives = 25/27 (92%) Frame = +2 Query: 284 RYYTIHKEVYKWFDISFDEFGRTSTPQ 364 +Y+ IH+EVYKWFDISFD FGRTSTPQ Sbjct: 97 KYHVIHREVYKWFDISFDHFGRTSTPQ 123