BLASTX nr result
ID: Akebia25_contig00063812
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00063812 (357 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS61480.1| hypothetical protein M569_13317, partial [Genlise... 58 1e-06 ref|XP_002309537.2| hypothetical protein POPTR_0006s25360g [Popu... 57 2e-06 ref|XP_002324791.2| hypothetical protein POPTR_0018s08180g [Popu... 57 3e-06 gb|EYU20422.1| hypothetical protein MIMGU_mgv1a007742mg [Mimulus... 55 8e-06 ref|XP_004501143.1| PREDICTED: monoglyceride lipase-like [Cicer ... 55 8e-06 >gb|EPS61480.1| hypothetical protein M569_13317, partial [Genlisea aurea] Length = 192 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/35 (77%), Positives = 29/35 (82%), Gaps = 6/35 (17%) Frame = -1 Query: 90 CNF------FVGHGGSDGLHGYVPSLDHVVADTVS 4 CNF ++GHGGSDGLHGYVPSLDHVVADTVS Sbjct: 158 CNFGVYAVDWIGHGGSDGLHGYVPSLDHVVADTVS 192 >ref|XP_002309537.2| hypothetical protein POPTR_0006s25360g [Populus trichocarpa] gi|550337060|gb|EEE93060.2| hypothetical protein POPTR_0006s25360g [Populus trichocarpa] Length = 388 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/36 (77%), Positives = 29/36 (80%), Gaps = 6/36 (16%) Frame = -1 Query: 90 CNFFV------GHGGSDGLHGYVPSLDHVVADTVSL 1 CNF V GHGGSDGLHGYVPSLDHVVADTV+L Sbjct: 153 CNFGVYAMDWTGHGGSDGLHGYVPSLDHVVADTVTL 188 >ref|XP_002324791.2| hypothetical protein POPTR_0018s08180g [Populus trichocarpa] gi|550318312|gb|EEF03356.2| hypothetical protein POPTR_0018s08180g [Populus trichocarpa] Length = 377 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/35 (74%), Positives = 29/35 (82%), Gaps = 6/35 (17%) Frame = -1 Query: 90 CNF------FVGHGGSDGLHGYVPSLDHVVADTVS 4 CNF ++GHGGSDGLHGYVPSLDHVVADTV+ Sbjct: 149 CNFGVYAMDWIGHGGSDGLHGYVPSLDHVVADTVT 183 >gb|EYU20422.1| hypothetical protein MIMGU_mgv1a007742mg [Mimulus guttatus] Length = 396 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/35 (71%), Positives = 28/35 (80%), Gaps = 6/35 (17%) Frame = -1 Query: 90 CNF------FVGHGGSDGLHGYVPSLDHVVADTVS 4 CNF ++GHGGSDGLHGYVPSLDHVVADT + Sbjct: 169 CNFGVYAMDWIGHGGSDGLHGYVPSLDHVVADTAA 203 >ref|XP_004501143.1| PREDICTED: monoglyceride lipase-like [Cicer arietinum] Length = 380 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/35 (71%), Positives = 28/35 (80%), Gaps = 6/35 (17%) Frame = -1 Query: 96 SFCNF------FVGHGGSDGLHGYVPSLDHVVADT 10 + CNF ++GHGGSDGLHGYVPSLDHVVADT Sbjct: 148 TLCNFGVYAMDWIGHGGSDGLHGYVPSLDHVVADT 182