BLASTX nr result
ID: Akebia25_contig00063782
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00063782 (325 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMC91412.1| hypothetical protein BAUCODRAFT_39585 [Baudoinia ... 58 2e-06 >gb|EMC91412.1| hypothetical protein BAUCODRAFT_39585 [Baudoinia compniacensis UAMH 10762] Length = 696 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/66 (40%), Positives = 40/66 (60%) Frame = -2 Query: 210 WHRLYPDILNQNPIHALESIPPRGRILYQHAISLYNAGKIYLRTSMYPKQRSTQVANKST 31 W R YP+ L+ HA + + R +++HA LY A IY RTSM+P QR+ +AN+S Sbjct: 520 WARSYPEFLSPESPHAGQHLSNEVRYVFEHAYVLYQAAVIYSRTSMFPAQRTIPMANQSE 579 Query: 30 IDAEIE 13 + A+ E Sbjct: 580 VHADTE 585