BLASTX nr result
ID: Akebia25_contig00063742
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00063742 (443 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003614501.1| hypothetical protein MTR_5g054740 [Medicago ... 43 3e-07 emb|CAN74319.1| hypothetical protein VITISV_035345 [Vitis vinifera] 38 6e-06 ref|XP_003598883.1| hypothetical protein MTR_3g022950 [Medicago ... 39 6e-06 >ref|XP_003614501.1| hypothetical protein MTR_5g054740 [Medicago truncatula] gi|355515836|gb|AES97459.1| hypothetical protein MTR_5g054740 [Medicago truncatula] Length = 878 Score = 43.1 bits (100), Expect(2) = 3e-07 Identities = 18/33 (54%), Positives = 25/33 (75%), Gaps = 1/33 (3%) Frame = +2 Query: 344 DESICKELW-EGNVGWC*QPSIGASGGIIVMWD 439 DE ICK LW + NVG+ QPS G++GG++ +WD Sbjct: 832 DELICKSLWGDLNVGFSFQPSFGSAGGVLTLWD 864 Score = 37.0 bits (84), Expect(2) = 3e-07 Identities = 17/43 (39%), Positives = 29/43 (67%) Frame = +1 Query: 211 G*MIKLLSWNVKGLGDWRIRAAVKAVIRSNKMHLVVLKESNLS 339 G ++K++SWNV+GLG + R V ++R K LV ++E+ L+ Sbjct: 787 GVVMKIISWNVRGLGGFEKRWEVIQLMREKKPFLVCIQETKLT 829 >emb|CAN74319.1| hypothetical protein VITISV_035345 [Vitis vinifera] Length = 1802 Score = 38.1 bits (87), Expect(2) = 6e-06 Identities = 16/37 (43%), Positives = 26/37 (70%) Frame = +1 Query: 220 IKLLSWNVKGLGDWRIRAAVKAVIRSNKMHLVVLKES 330 IK++SWN +GLG + R VK +RS K +V+++E+ Sbjct: 780 IKIISWNTRGLGSRKKRRVVKDFLRSEKPDIVMIQET 816 Score = 37.4 bits (85), Expect(2) = 6e-06 Identities = 17/34 (50%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = +2 Query: 341 CDESICKELWEG-NVGWC*QPSIGASGGIIVMWD 439 CD LW N W P+ GASGGI+VMWD Sbjct: 821 CDRRFVGSLWTARNKEWAVLPACGASGGILVMWD 854 >ref|XP_003598883.1| hypothetical protein MTR_3g022950 [Medicago truncatula] gi|355487931|gb|AES69134.1| hypothetical protein MTR_3g022950 [Medicago truncatula] Length = 840 Score = 38.9 bits (89), Expect(2) = 6e-06 Identities = 18/39 (46%), Positives = 27/39 (69%), Gaps = 1/39 (2%) Frame = +2 Query: 326 SQI*VCDESICKELWEGN-VGWC*QPSIGASGGIIVMWD 439 S++ V ++ +CK LW N V + QPS GASGG+I +W+ Sbjct: 688 SKLSVVNDIVCKGLWNDNHVDFSFQPSSGASGGLITLWN 726 Score = 36.6 bits (83), Expect(2) = 6e-06 Identities = 16/39 (41%), Positives = 25/39 (64%) Frame = +1 Query: 226 LLSWNVKGLGDWRIRAAVKAVIRSNKMHLVVLKESNLSV 342 ++SWNV+GLG + R V ++R ++ L+ES LSV Sbjct: 654 IISWNVRGLGGFEKRREVSNLVREKNPFILCLQESKLSV 692