BLASTX nr result
ID: Akebia25_contig00063711
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00063711 (366 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ETN38619.1| hypothetical protein HMPREF1541_06656 [Cyphelloph... 59 9e-07 >gb|ETN38619.1| hypothetical protein HMPREF1541_06656 [Cyphellophora europaea CBS 101466] Length = 425 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/57 (43%), Positives = 35/57 (61%) Frame = +3 Query: 18 PDILSGLFTDIDAAQDKIGTEINKITDSLGCPALNDIEKEQFDKYPGYTKIKTDGSY 188 PD+L GL +D+ A +KI + LGCP L I+ Q ++PGYTK+K DG+Y Sbjct: 369 PDLLKGLLSDVTGAVNKITDSLGDTLVQLGCPQLEKIDDSQLSQFPGYTKLKGDGTY 425