BLASTX nr result
ID: Akebia25_contig00063543
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00063543 (291 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ETS73067.1| hypothetical protein PFICI_15242 [Pestalotiopsis ... 62 1e-07 gb|ENH80405.1| hypothetical protein Cob_10807 [Colletotrichum or... 57 3e-06 emb|CCE35104.1| uncharacterized protein CPUR_02033 [Claviceps pu... 55 1e-05 >gb|ETS73067.1| hypothetical protein PFICI_15242 [Pestalotiopsis fici W106-1] Length = 177 Score = 61.6 bits (148), Expect = 1e-07 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = +2 Query: 170 MSEPLTKVDSAVEGLNPTTPEKKKTRMSSSAPGVMNIEDL 289 MSEPL+KVDSAV+GLN P KKTRMSSSAPGVMNI+DL Sbjct: 1 MSEPLSKVDSAVQGLNEAPP--KKTRMSSSAPGVMNIDDL 38 >gb|ENH80405.1| hypothetical protein Cob_10807 [Colletotrichum orbiculare MAFF 240422] Length = 170 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/40 (65%), Positives = 35/40 (87%) Frame = +2 Query: 170 MSEPLTKVDSAVEGLNPTTPEKKKTRMSSSAPGVMNIEDL 289 MSEPLTKVDSAV+GL+ + P++K+ + S++APGVMNI DL Sbjct: 1 MSEPLTKVDSAVQGLSSSPPKEKRRQSSAAAPGVMNINDL 40 >emb|CCE35104.1| uncharacterized protein CPUR_02033 [Claviceps purpurea 20.1] Length = 170 Score = 55.1 bits (131), Expect = 1e-05 Identities = 29/41 (70%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Frame = +2 Query: 170 MSEPLTKVDSAVEGLNPTTP-EKKKTRMSSSAPGVMNIEDL 289 MSEPLTKVDSAV+GL+ + P EK R SSSAPGVMN+ DL Sbjct: 1 MSEPLTKVDSAVQGLSSSPPKEKGHRRQSSSAPGVMNVTDL 41