BLASTX nr result
ID: Akebia25_contig00063516
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00063516 (261 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525467.1| transcription factor, putative [Ricinus comm... 56 6e-06 >ref|XP_002525467.1| transcription factor, putative [Ricinus communis] gi|223535280|gb|EEF36957.1| transcription factor, putative [Ricinus communis] Length = 365 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/54 (53%), Positives = 42/54 (77%) Frame = -3 Query: 232 EKEEEYEPLIQDDVQSALPTLLPNQYNLKPQKSSSFSDLLRGMDYSILTSFMSD 71 E+EEE E +++++ +L T + N+ +L PQKSSSFS+LL MDYSIL+SF+SD Sbjct: 195 EEEEEEEQFVKENILPSLKTPIANK-SLIPQKSSSFSNLLDAMDYSILSSFLSD 247