BLASTX nr result
ID: Akebia25_contig00063261
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00063261 (236 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI26082.3| unnamed protein product [Vitis vinifera] 140 2e-31 ref|XP_002276230.1| PREDICTED: pentatricopeptide repeat-containi... 140 2e-31 emb|CAN78051.1| hypothetical protein VITISV_015864 [Vitis vinifera] 140 2e-31 ref|XP_006489265.1| PREDICTED: pentatricopeptide repeat-containi... 139 5e-31 ref|XP_006419615.1| hypothetical protein CICLE_v10004576mg [Citr... 139 5e-31 ref|XP_006380176.1| pentatricopeptide repeat-containing family p... 138 9e-31 ref|XP_004295496.1| PREDICTED: pentatricopeptide repeat-containi... 136 3e-30 ref|XP_007224962.1| hypothetical protein PRUPE_ppa021143mg [Prun... 135 5e-30 ref|XP_004165782.1| PREDICTED: pentatricopeptide repeat-containi... 135 5e-30 ref|XP_004143199.1| PREDICTED: pentatricopeptide repeat-containi... 135 5e-30 ref|XP_003609638.1| Pentatricopeptide repeat-containing protein ... 133 2e-29 ref|XP_003529581.1| PREDICTED: pentatricopeptide repeat-containi... 133 3e-29 ref|XP_002516898.1| pentatricopeptide repeat-containing protein,... 132 5e-29 ref|XP_004513068.1| PREDICTED: pentatricopeptide repeat-containi... 130 2e-28 ref|XP_007035546.1| Tetratricopeptide repeat-like superfamily pr... 130 2e-28 gb|EXB74809.1| hypothetical protein L484_023553 [Morus notabilis] 126 4e-27 ref|XP_002870213.1| pentatricopeptide repeat-containing protein ... 117 2e-24 ref|XP_002441873.1| hypothetical protein SORBIDRAFT_08g003980 [S... 117 2e-24 emb|CAB10350.1| hypothetical protein [Arabidopsis thaliana] gi|7... 116 4e-24 ref|NP_193307.2| pentatricopeptide repeat-containing protein [Ar... 116 4e-24 >emb|CBI26082.3| unnamed protein product [Vitis vinifera] Length = 568 Score = 140 bits (352), Expect = 2e-31 Identities = 68/78 (87%), Positives = 72/78 (92%) Frame = +2 Query: 2 LVFVDVEEEAKEVIVGLHSEKLALGFGLISIPKGVPIRVMKNLRMCGDCHQTFKLISEIV 181 LV +DVEEEAKE IVGLHSE+LAL FGLISIPKGV IRVMKNLRMC DCH+ FKLISEIV Sbjct: 483 LVSIDVEEEAKEEIVGLHSERLALAFGLISIPKGVTIRVMKNLRMCRDCHEAFKLISEIV 542 Query: 182 ERDFVVRDVNRFHHFKNG 235 ERDFVVRDVNRFHHF+NG Sbjct: 543 ERDFVVRDVNRFHHFENG 560 >ref|XP_002276230.1| PREDICTED: pentatricopeptide repeat-containing protein At4g15720-like [Vitis vinifera] Length = 606 Score = 140 bits (352), Expect = 2e-31 Identities = 68/78 (87%), Positives = 72/78 (92%) Frame = +2 Query: 2 LVFVDVEEEAKEVIVGLHSEKLALGFGLISIPKGVPIRVMKNLRMCGDCHQTFKLISEIV 181 LV +DVEEEAKE IVGLHSE+LAL FGLISIPKGV IRVMKNLRMC DCH+ FKLISEIV Sbjct: 521 LVSIDVEEEAKEEIVGLHSERLALAFGLISIPKGVTIRVMKNLRMCRDCHEAFKLISEIV 580 Query: 182 ERDFVVRDVNRFHHFKNG 235 ERDFVVRDVNRFHHF+NG Sbjct: 581 ERDFVVRDVNRFHHFENG 598 >emb|CAN78051.1| hypothetical protein VITISV_015864 [Vitis vinifera] Length = 231 Score = 140 bits (352), Expect = 2e-31 Identities = 68/78 (87%), Positives = 72/78 (92%) Frame = +2 Query: 2 LVFVDVEEEAKEVIVGLHSEKLALGFGLISIPKGVPIRVMKNLRMCGDCHQTFKLISEIV 181 LV +DVEEEAKE IVGLHSE+LAL FGLISIPKGV IRVMKNLRMC DCH+ FKLISEIV Sbjct: 146 LVSIDVEEEAKEEIVGLHSERLALAFGLISIPKGVTIRVMKNLRMCRDCHEAFKLISEIV 205 Query: 182 ERDFVVRDVNRFHHFKNG 235 ERDFVVRDVNRFHHF+NG Sbjct: 206 ERDFVVRDVNRFHHFENG 223 >ref|XP_006489265.1| PREDICTED: pentatricopeptide repeat-containing protein At4g15720-like [Citrus sinensis] Length = 605 Score = 139 bits (349), Expect = 5e-31 Identities = 65/78 (83%), Positives = 72/78 (92%) Frame = +2 Query: 2 LVFVDVEEEAKEVIVGLHSEKLALGFGLISIPKGVPIRVMKNLRMCGDCHQTFKLISEIV 181 LVFVDVE+EA+E IVGLHSE+LAL FGLISIPKG+ IR+MKNLRMC DCH FKLIS+IV Sbjct: 520 LVFVDVEDEAREEIVGLHSERLALAFGLISIPKGITIRIMKNLRMCRDCHDVFKLISDIV 579 Query: 182 ERDFVVRDVNRFHHFKNG 235 ERDFVVRDVNRFHHF+NG Sbjct: 580 ERDFVVRDVNRFHHFRNG 597 >ref|XP_006419615.1| hypothetical protein CICLE_v10004576mg [Citrus clementina] gi|557521488|gb|ESR32855.1| hypothetical protein CICLE_v10004576mg [Citrus clementina] Length = 605 Score = 139 bits (349), Expect = 5e-31 Identities = 65/78 (83%), Positives = 72/78 (92%) Frame = +2 Query: 2 LVFVDVEEEAKEVIVGLHSEKLALGFGLISIPKGVPIRVMKNLRMCGDCHQTFKLISEIV 181 LVFVDVE+EA+E IVGLHSE+LAL FGLISIPKG+ IR+MKNLRMC DCH FKLIS+IV Sbjct: 520 LVFVDVEDEAREEIVGLHSERLALAFGLISIPKGITIRIMKNLRMCRDCHDVFKLISDIV 579 Query: 182 ERDFVVRDVNRFHHFKNG 235 ERDFVVRDVNRFHHF+NG Sbjct: 580 ERDFVVRDVNRFHHFRNG 597 >ref|XP_006380176.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550333697|gb|ERP57973.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 584 Score = 138 bits (347), Expect = 9e-31 Identities = 66/78 (84%), Positives = 72/78 (92%) Frame = +2 Query: 2 LVFVDVEEEAKEVIVGLHSEKLALGFGLISIPKGVPIRVMKNLRMCGDCHQTFKLISEIV 181 LVFVDVE+E KE IVGLHSE+LAL FGLISIPKGV IRVMKNLR+C DCH+ FKLIS+IV Sbjct: 499 LVFVDVEQEVKEKIVGLHSERLALAFGLISIPKGVTIRVMKNLRICSDCHEAFKLISKIV 558 Query: 182 ERDFVVRDVNRFHHFKNG 235 ERDFVVRDVNRFHHFK+G Sbjct: 559 ERDFVVRDVNRFHHFKDG 576 >ref|XP_004295496.1| PREDICTED: pentatricopeptide repeat-containing protein At4g15720-like [Fragaria vesca subsp. vesca] Length = 583 Score = 136 bits (342), Expect = 3e-30 Identities = 63/78 (80%), Positives = 71/78 (91%) Frame = +2 Query: 2 LVFVDVEEEAKEVIVGLHSEKLALGFGLISIPKGVPIRVMKNLRMCGDCHQTFKLISEIV 181 LVF+DVEEEAKE IVGLHSE+LALGF L+SIPKGV IR+MKNLRMC DCH+ FKLIS+IV Sbjct: 498 LVFIDVEEEAKEEIVGLHSERLALGFALLSIPKGVTIRIMKNLRMCNDCHEAFKLISDIV 557 Query: 182 ERDFVVRDVNRFHHFKNG 235 R+F+VRDVNRFHHFK G Sbjct: 558 GREFIVRDVNRFHHFKGG 575 >ref|XP_007224962.1| hypothetical protein PRUPE_ppa021143mg [Prunus persica] gi|462421898|gb|EMJ26161.1| hypothetical protein PRUPE_ppa021143mg [Prunus persica] Length = 602 Score = 135 bits (341), Expect = 5e-30 Identities = 65/78 (83%), Positives = 72/78 (92%) Frame = +2 Query: 2 LVFVDVEEEAKEVIVGLHSEKLALGFGLISIPKGVPIRVMKNLRMCGDCHQTFKLISEIV 181 LVFVDVEEEAKE IVGLHSE+LALGF L+SIPKGV IR+MKNLRMC DCH+ FKLIS+IV Sbjct: 517 LVFVDVEEEAKEGIVGLHSERLALGFALLSIPKGVTIRIMKNLRMCRDCHEAFKLISDIV 576 Query: 182 ERDFVVRDVNRFHHFKNG 235 ER+ VVRDVNRFHHFK+G Sbjct: 577 ERECVVRDVNRFHHFKSG 594 >ref|XP_004165782.1| PREDICTED: pentatricopeptide repeat-containing protein At4g15720-like [Cucumis sativus] Length = 603 Score = 135 bits (341), Expect = 5e-30 Identities = 63/78 (80%), Positives = 72/78 (92%) Frame = +2 Query: 2 LVFVDVEEEAKEVIVGLHSEKLALGFGLISIPKGVPIRVMKNLRMCGDCHQTFKLISEIV 181 LVFVD+EEEA+E V LHSE+LALGFGLISIPKG+ IR+MKNLRMC DCH+ FKLISEI+ Sbjct: 518 LVFVDIEEEAEEEKVWLHSERLALGFGLISIPKGLTIRIMKNLRMCSDCHEAFKLISEIM 577 Query: 182 ERDFVVRDVNRFHHFKNG 235 ER+FVVRD+NRFHHFKNG Sbjct: 578 EREFVVRDINRFHHFKNG 595 >ref|XP_004143199.1| PREDICTED: pentatricopeptide repeat-containing protein At4g15720-like [Cucumis sativus] Length = 603 Score = 135 bits (341), Expect = 5e-30 Identities = 63/78 (80%), Positives = 72/78 (92%) Frame = +2 Query: 2 LVFVDVEEEAKEVIVGLHSEKLALGFGLISIPKGVPIRVMKNLRMCGDCHQTFKLISEIV 181 LVFVD+EEEA+E V LHSE+LALGFGLISIPKG+ IR+MKNLRMC DCH+ FKLISEI+ Sbjct: 518 LVFVDIEEEAEEEKVWLHSERLALGFGLISIPKGLTIRIMKNLRMCSDCHEAFKLISEIM 577 Query: 182 ERDFVVRDVNRFHHFKNG 235 ER+FVVRD+NRFHHFKNG Sbjct: 578 EREFVVRDINRFHHFKNG 595 >ref|XP_003609638.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355510693|gb|AES91835.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 589 Score = 133 bits (335), Expect = 2e-29 Identities = 63/78 (80%), Positives = 70/78 (89%) Frame = +2 Query: 2 LVFVDVEEEAKEVIVGLHSEKLALGFGLISIPKGVPIRVMKNLRMCGDCHQTFKLISEIV 181 LVFVDVEEEAKE IV LHSEKLAL FGL++ PKG+ I +MKNLRMC DCH+ FKLIS+IV Sbjct: 504 LVFVDVEEEAKEEIVSLHSEKLALAFGLLNTPKGITIIIMKNLRMCRDCHEAFKLISDIV 563 Query: 182 ERDFVVRDVNRFHHFKNG 235 ER+FVVRDVNRFHHFKNG Sbjct: 564 EREFVVRDVNRFHHFKNG 581 >ref|XP_003529581.1| PREDICTED: pentatricopeptide repeat-containing protein At4g15720-like [Glycine max] Length = 603 Score = 133 bits (334), Expect = 3e-29 Identities = 64/78 (82%), Positives = 69/78 (88%) Frame = +2 Query: 2 LVFVDVEEEAKEVIVGLHSEKLALGFGLISIPKGVPIRVMKNLRMCGDCHQTFKLISEIV 181 LVFVDVEEEAKE IV +HSEKLAL FGLI+ PKGV IR+MKNLRMC DCH FKLIS+IV Sbjct: 518 LVFVDVEEEAKEEIVSMHSEKLALAFGLINTPKGVTIRIMKNLRMCRDCHGAFKLISDIV 577 Query: 182 ERDFVVRDVNRFHHFKNG 235 ER+ VVRDVNRFHHFKNG Sbjct: 578 ERELVVRDVNRFHHFKNG 595 >ref|XP_002516898.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223543986|gb|EEF45512.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 406 Score = 132 bits (332), Expect = 5e-29 Identities = 62/78 (79%), Positives = 69/78 (88%) Frame = +2 Query: 2 LVFVDVEEEAKEVIVGLHSEKLALGFGLISIPKGVPIRVMKNLRMCGDCHQTFKLISEIV 181 LVFVDVE+EAKE IV LHSE+LAL F L+SIPKG+ +RVMKNLRMC DCH+ FKLIS IV Sbjct: 321 LVFVDVEQEAKEEIVSLHSERLALAFALLSIPKGITVRVMKNLRMCKDCHEAFKLISGIV 380 Query: 182 ERDFVVRDVNRFHHFKNG 235 ERDFVVRD+NRFHHF NG Sbjct: 381 ERDFVVRDINRFHHFDNG 398 >ref|XP_004513068.1| PREDICTED: pentatricopeptide repeat-containing protein At4g15720-like [Cicer arietinum] Length = 605 Score = 130 bits (327), Expect = 2e-28 Identities = 60/78 (76%), Positives = 70/78 (89%) Frame = +2 Query: 2 LVFVDVEEEAKEVIVGLHSEKLALGFGLISIPKGVPIRVMKNLRMCGDCHQTFKLISEIV 181 LVFVDVEEEAKE IV LHSEKLAL FGL++ KG+ IR+MKNLRMC DCH+ FK+IS+IV Sbjct: 520 LVFVDVEEEAKEEIVSLHSEKLALAFGLLNTSKGITIRIMKNLRMCMDCHEAFKVISDIV 579 Query: 182 ERDFVVRDVNRFHHFKNG 235 ER+F+VRD+NRFHHFKNG Sbjct: 580 EREFIVRDLNRFHHFKNG 597 >ref|XP_007035546.1| Tetratricopeptide repeat-like superfamily protein [Theobroma cacao] gi|508714575|gb|EOY06472.1| Tetratricopeptide repeat-like superfamily protein [Theobroma cacao] Length = 648 Score = 130 bits (326), Expect = 2e-28 Identities = 63/78 (80%), Positives = 67/78 (85%) Frame = +2 Query: 2 LVFVDVEEEAKEVIVGLHSEKLALGFGLISIPKGVPIRVMKNLRMCGDCHQTFKLISEIV 181 LVFVDVEEEAK +VGLHSEKLAL FGLI+IPKGV IR+MKNLRMC DCH+ FK ISEI Sbjct: 563 LVFVDVEEEAKGEMVGLHSEKLALAFGLINIPKGVTIRIMKNLRMCRDCHEAFKWISEIT 622 Query: 182 ERDFVVRDVNRFHHFKNG 235 ERD VVRDVNRFHHF G Sbjct: 623 ERDIVVRDVNRFHHFDKG 640 >gb|EXB74809.1| hypothetical protein L484_023553 [Morus notabilis] Length = 605 Score = 126 bits (316), Expect = 4e-27 Identities = 57/78 (73%), Positives = 68/78 (87%) Frame = +2 Query: 2 LVFVDVEEEAKEVIVGLHSEKLALGFGLISIPKGVPIRVMKNLRMCGDCHQTFKLISEIV 181 LVFVDV+EE +E I+GLHSE+LAL FGLI++PK IR+MKN+RMC DCH+ FKLISEI+ Sbjct: 520 LVFVDVDEETEEEILGLHSERLALAFGLINLPKSATIRIMKNIRMCRDCHEAFKLISEIL 579 Query: 182 ERDFVVRDVNRFHHFKNG 235 ERDF+VRD NRFHHF NG Sbjct: 580 ERDFIVRDNNRFHHFTNG 597 >ref|XP_002870213.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297316049|gb|EFH46472.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 608 Score = 117 bits (293), Expect = 2e-24 Identities = 55/77 (71%), Positives = 64/77 (83%) Frame = +2 Query: 5 VFVDVEEEAKEVIVGLHSEKLALGFGLISIPKGVPIRVMKNLRMCGDCHQTFKLISEIVE 184 VFVDV+EEAKE +V LH E+LAL +GL+ +P G IR+M NLRMC DCH+ FKLISEIVE Sbjct: 524 VFVDVDEEAKEEMVSLHCERLALAYGLLHLPAGSTIRIMNNLRMCRDCHEAFKLISEIVE 583 Query: 185 RDFVVRDVNRFHHFKNG 235 R+ VVRDVNRFH FKNG Sbjct: 584 REIVVRDVNRFHCFKNG 600 >ref|XP_002441873.1| hypothetical protein SORBIDRAFT_08g003980 [Sorghum bicolor] gi|241942566|gb|EES15711.1| hypothetical protein SORBIDRAFT_08g003980 [Sorghum bicolor] Length = 599 Score = 117 bits (292), Expect = 2e-24 Identities = 55/74 (74%), Positives = 63/74 (85%) Frame = +2 Query: 14 DVEEEAKEVIVGLHSEKLALGFGLISIPKGVPIRVMKNLRMCGDCHQTFKLISEIVERDF 193 D EEE K V+VG+HSE LAL FGL+ +PKG+ IRVMKNLRMC DCH+ FKLIS IVER+F Sbjct: 518 DDEEEGKGVMVGVHSEILALAFGLLVVPKGMTIRVMKNLRMCSDCHEVFKLISGIVEREF 577 Query: 194 VVRDVNRFHHFKNG 235 VVRD+NRFHHFK G Sbjct: 578 VVRDLNRFHHFKMG 591 >emb|CAB10350.1| hypothetical protein [Arabidopsis thaliana] gi|7268320|emb|CAB78614.1| hypothetical protein [Arabidopsis thaliana] Length = 602 Score = 116 bits (290), Expect = 4e-24 Identities = 54/77 (70%), Positives = 64/77 (83%) Frame = +2 Query: 5 VFVDVEEEAKEVIVGLHSEKLALGFGLISIPKGVPIRVMKNLRMCGDCHQTFKLISEIVE 184 VFVDV+EEAK+ +V LH E+LAL +GL+ +P G IR+M NLRMC DCH+ FKLISEIVE Sbjct: 518 VFVDVDEEAKDEMVSLHCERLALAYGLLHLPAGSTIRIMNNLRMCRDCHEAFKLISEIVE 577 Query: 185 RDFVVRDVNRFHHFKNG 235 R+ VVRDVNRFH FKNG Sbjct: 578 REIVVRDVNRFHCFKNG 594 >ref|NP_193307.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75161477|sp|Q8VYH0.1|PP313_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g15720 gi|18175616|gb|AAL59897.1| unknown protein [Arabidopsis thaliana] gi|20465541|gb|AAM20253.1| unknown protein [Arabidopsis thaliana] gi|332658240|gb|AEE83640.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 616 Score = 116 bits (290), Expect = 4e-24 Identities = 54/77 (70%), Positives = 64/77 (83%) Frame = +2 Query: 5 VFVDVEEEAKEVIVGLHSEKLALGFGLISIPKGVPIRVMKNLRMCGDCHQTFKLISEIVE 184 VFVDV+EEAK+ +V LH E+LAL +GL+ +P G IR+M NLRMC DCH+ FKLISEIVE Sbjct: 532 VFVDVDEEAKDEMVSLHCERLALAYGLLHLPAGSTIRIMNNLRMCRDCHEAFKLISEIVE 591 Query: 185 RDFVVRDVNRFHHFKNG 235 R+ VVRDVNRFH FKNG Sbjct: 592 REIVVRDVNRFHCFKNG 608