BLASTX nr result
ID: Akebia25_contig00063052
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00063052 (303 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMC99306.1| hypothetical protein BAUCODRAFT_31625 [Baudoinia ... 75 7e-12 >gb|EMC99306.1| hypothetical protein BAUCODRAFT_31625 [Baudoinia compniacensis UAMH 10762] Length = 296 Score = 75.5 bits (184), Expect = 7e-12 Identities = 34/57 (59%), Positives = 45/57 (78%), Gaps = 1/57 (1%) Frame = +1 Query: 1 LGQTTKEAV-VDGRKVWMNPLVRAKGRLLYSKGRMGKVFDNNEEWSAFENTLSLDEK 168 LG+ TK A VDG +VW+N LV+ KGRL YSKGRMG+V+D EWSAF++TL+ +E+ Sbjct: 239 LGRVTKAATTVDGNEVWLNTLVKGKGRLAYSKGRMGRVYDQQSEWSAFDSTLNAEER 295