BLASTX nr result
ID: Akebia25_contig00062932
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00062932 (290 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EON63960.1| hypothetical protein W97_03189 [Coniosporium apol... 81 2e-13 >gb|EON63960.1| hypothetical protein W97_03189 [Coniosporium apollinis CBS 100218] Length = 1039 Score = 80.9 bits (198), Expect = 2e-13 Identities = 42/97 (43%), Positives = 55/97 (56%), Gaps = 3/97 (3%) Frame = +3 Query: 6 QQTP--PAADAGHHDEDPHLAYAEPDTPPRTDNAPKMSF-FDKARGAVHKLGGDVRSKFS 176 QQ P PA EDP+ + +P P + MSF FDK GAVH +G +++ + + Sbjct: 43 QQQPNVPAPYNPQSSEDPYQYHYQPQKPTSSGG---MSFLFDKLHGAVHGVGAELKDRLA 99 Query: 177 GADSSHSHTHDSGVCSDGTHDHVAHNRYDSFPPSLSG 287 + +H HTH SG CSDGTHDH A NR+ SF P G Sbjct: 100 AREETHGHTHPSGQCSDGTHDHHAENRFHSFAPQREG 136