BLASTX nr result
ID: Akebia25_contig00062777
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00062777 (433 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006300939.1| hypothetical protein CARUB_v10021318mg, part... 58 2e-06 ref|NP_001031892.1| RNA-directed DNA polymerase (reverse transcr... 57 3e-06 >ref|XP_006300939.1| hypothetical protein CARUB_v10021318mg, partial [Capsella rubella] gi|482569649|gb|EOA33837.1| hypothetical protein CARUB_v10021318mg, partial [Capsella rubella] Length = 290 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/56 (44%), Positives = 33/56 (58%) Frame = +2 Query: 11 GEHVEWYKIIWNKFRIPWHTFITWVVLRRSLQANENRCRRGLTLPSRCVLCCKSGE 178 G V W+K +W K RIP H FI+WVV+R L + G+ +PS C+LC S E Sbjct: 108 GPLVPWFKSVWFKERIPKHAFISWVVIRNRLTTRDRLRGWGMNVPSECLLCTSSAE 163 >ref|NP_001031892.1| RNA-directed DNA polymerase (reverse transcriptase)-related family protein [Arabidopsis thaliana] gi|98962153|gb|ABF59406.1| unknown protein [Arabidopsis thaliana] gi|332004916|gb|AED92299.1| RNA-directed DNA polymerase (reverse transcriptase)-related family protein [Arabidopsis thaliana] Length = 209 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/51 (49%), Positives = 32/51 (62%) Frame = +2 Query: 11 GEHVEWYKIIWNKFRIPWHTFITWVVLRRSLQANENRCRRGLTLPSRCVLC 163 GE V+W+K IW K RIP H FI+WV +R L + GL +PS C+LC Sbjct: 139 GEKVDWHKAIWFKGRIPKHAFISWVNIRHRLPTRDKLLSWGLHVPSLCLLC 189