BLASTX nr result
ID: Akebia25_contig00062773
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00062773 (296 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_641698.1| hypothetical protein DDB_G0279557 [Dictyosteliu... 96 4e-18 ref|XP_003288836.1| hypothetical protein DICPUDRAFT_98148 [Dicty... 94 2e-17 >ref|XP_641698.1| hypothetical protein DDB_G0279557 [Dictyostelium discoideum AX4] gi|60469729|gb|EAL67717.1| hypothetical protein DDB_G0279557 [Dictyostelium discoideum AX4] Length = 782 Score = 96.3 bits (238), Expect = 4e-18 Identities = 46/52 (88%), Positives = 50/52 (96%) Frame = +3 Query: 6 LLQDKYANFVIQTALDVANDDQHAHLVKMILPYIHQIKTPYVMHIQKKILQV 161 LLQDKYANFVIQTALDV+ND QHA LVK+I+PYIHQIKTPYV+HIQKKILQV Sbjct: 731 LLQDKYANFVIQTALDVSNDTQHAKLVKIIVPYIHQIKTPYVIHIQKKILQV 782 >ref|XP_003288836.1| hypothetical protein DICPUDRAFT_98148 [Dictyostelium purpureum] gi|325081082|gb|EGC34611.1| hypothetical protein DICPUDRAFT_98148 [Dictyostelium purpureum] Length = 738 Score = 94.0 bits (232), Expect = 2e-17 Identities = 45/52 (86%), Positives = 50/52 (96%) Frame = +3 Query: 6 LLQDKYANFVIQTALDVANDDQHAHLVKMILPYIHQIKTPYVMHIQKKILQV 161 LLQDKYANFVIQTALDVA++ QHA LVK+I+PYIHQIKTPYV+HIQKKILQV Sbjct: 687 LLQDKYANFVIQTALDVADEAQHAKLVKLIVPYIHQIKTPYVIHIQKKILQV 738