BLASTX nr result
ID: Akebia25_contig00062629
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00062629 (713 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002534720.1| conserved hypothetical protein [Ricinus comm... 97 4e-18 emb|CAN65986.1| hypothetical protein VITISV_042143 [Vitis vinifera] 75 2e-11 ref|XP_003588351.1| Maturase [Medicago truncatula] gi|355477399|... 61 2e-09 >ref|XP_002534720.1| conserved hypothetical protein [Ricinus communis] gi|223524693|gb|EEF27662.1| conserved hypothetical protein [Ricinus communis] Length = 77 Score = 97.4 bits (241), Expect = 4e-18 Identities = 45/50 (90%), Positives = 46/50 (92%), Gaps = 1/50 (2%) Frame = -3 Query: 372 MQLYGPLIGPDRWWYHTLLKGTVRDTLASYGSVPESG-PPLSFDQRVLEP 226 MQL GPL+GPDRWWYHTLLKGTVRDTLASYGS PESG PP SFDQRVLEP Sbjct: 1 MQLRGPLVGPDRWWYHTLLKGTVRDTLASYGSAPESGPPPFSFDQRVLEP 50 >emb|CAN65986.1| hypothetical protein VITISV_042143 [Vitis vinifera] Length = 138 Score = 75.1 bits (183), Expect = 2e-11 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = -1 Query: 338 GGGIIPFSKEPYVTLSRHTAPSRNQDLPFPLINGSSN 228 GGGI PFSKEPYVTLSRHTAPSRN+DLPFPL NGSSN Sbjct: 20 GGGITPFSKEPYVTLSRHTAPSRNKDLPFPLTNGSSN 56 Score = 57.0 bits (136), Expect = 6e-06 Identities = 43/107 (40%), Positives = 54/107 (50%) Frame = -2 Query: 424 GDQPPEESDVHGPEVRRDAALWPAHRA**VVVSYPSQRNRT*HSRVIRLRPGIRTSPFL* 245 G QPP ES+VHGP + P + V +S + +R + PF Sbjct: 7 GGQPPGESNVHGP----GGGITPFSKEPYVTLSRHTAPSRN------------KDLPFPL 50 Query: 244 STGPRTPCMEVTLNSFID*FKVALACFQVQALAVEASRQKLTSGPGR 104 + G + +S VA+ACFQVQALAVEASRQKLTSGPGR Sbjct: 51 TNGSSNQPVPPFYSS------VAVACFQVQALAVEASRQKLTSGPGR 91 >ref|XP_003588351.1| Maturase [Medicago truncatula] gi|355477399|gb|AES58602.1| Maturase [Medicago truncatula] Length = 996 Score = 60.8 bits (146), Expect(2) = 2e-09 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = +1 Query: 289 RESVTYGSFEKGMIPPPIRPDERAIELHPYAP 384 RE++TYGSFEKG+ PPPIRPDER+ ELHPY+P Sbjct: 880 RENLTYGSFEKGVRPPPIRPDERSTELHPYSP 911 Score = 28.1 bits (61), Expect(2) = 2e-09 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +3 Query: 387 GPCTSLSSGGWSP 425 GPCT LS GGW P Sbjct: 912 GPCTLLSPGGWPP 924