BLASTX nr result
ID: Akebia25_contig00062435
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00062435 (333 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EGO54787.1| hypothetical protein NEUTE1DRAFT_118316 [Neurospo... 62 8e-08 ref|XP_956635.1| hypothetical protein NCU05137 [Neurospora crass... 62 8e-08 ref|XP_003049149.1| hypothetical protein NECHADRAFT_45195 [Nectr... 59 5e-07 gb|EFY86901.1| extracellular serine-rich protein [Metarhizium ac... 58 1e-06 gb|EFY95584.1| extracellular serine-rich protein, putative [Meta... 57 2e-06 gb|ESZ97904.1| hypothetical protein SBOR_1703 [Sclerotinia borea... 57 3e-06 >gb|EGO54787.1| hypothetical protein NEUTE1DRAFT_118316 [Neurospora tetrasperma FGSC 2508] gi|350286482|gb|EGZ67729.1| hypothetical protein NEUTE2DRAFT_145717 [Neurospora tetrasperma FGSC 2509] Length = 701 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/44 (65%), Positives = 33/44 (75%) Frame = +3 Query: 3 IPVTFPGDASGSGTKDKIGNEPLIMWVTLSGQPVTLTLSTPLAI 134 IPVT P ASGS T D +GNEP I W TLSG PVTLTLS+ ++I Sbjct: 658 IPVTVPASASGSATVDALGNEPKIYWTTLSGSPVTLTLSSQISI 701 >ref|XP_956635.1| hypothetical protein NCU05137 [Neurospora crassa OR74A] gi|28881427|emb|CAD70544.1| hypothetical protein [Neurospora crassa] gi|28917707|gb|EAA27399.1| non-anchored cell wall protein 1 [Neurospora crassa OR74A] Length = 691 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/44 (65%), Positives = 33/44 (75%) Frame = +3 Query: 3 IPVTFPGDASGSGTKDKIGNEPLIMWVTLSGQPVTLTLSTPLAI 134 IPVT P ASGS T D +GNEP I W TLSG PVTLTLS+ ++I Sbjct: 648 IPVTVPASASGSATVDALGNEPKIYWTTLSGSPVTLTLSSQISI 691 >ref|XP_003049149.1| hypothetical protein NECHADRAFT_45195 [Nectria haematococca mpVI 77-13-4] gi|256730084|gb|EEU43436.1| hypothetical protein NECHADRAFT_45195 [Nectria haematococca mpVI 77-13-4] Length = 664 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/47 (61%), Positives = 34/47 (72%), Gaps = 3/47 (6%) Frame = +3 Query: 3 IPVTFPGDASGSG---TKDKIGNEPLIMWVTLSGQPVTLTLSTPLAI 134 +PVT PG AS SG + D +G+EP I WVTLSG PVTLTLS PL + Sbjct: 618 VPVTVPGGASASGGSSSSDTLGSEPTIEWVTLSGSPVTLTLSQPLTV 664 >gb|EFY86901.1| extracellular serine-rich protein [Metarhizium acridum CQMa 102] Length = 624 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/48 (58%), Positives = 34/48 (70%), Gaps = 4/48 (8%) Frame = +3 Query: 3 IPVTFPGD----ASGSGTKDKIGNEPLIMWVTLSGQPVTLTLSTPLAI 134 +PVT P + GS T D +GNEP I+WVTLSG PVTLTLSTP+ + Sbjct: 576 VPVTIPSGTVSASGGSPTSDNLGNEPPIVWVTLSGSPVTLTLSTPVKL 623 >gb|EFY95584.1| extracellular serine-rich protein, putative [Metarhizium anisopliae ARSEF 23] Length = 692 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/48 (58%), Positives = 34/48 (70%), Gaps = 4/48 (8%) Frame = +3 Query: 3 IPVTFPGD----ASGSGTKDKIGNEPLIMWVTLSGQPVTLTLSTPLAI 134 +PVT P +SGS D +GNEP I+WVTLSG PVTLTLSTP+ + Sbjct: 644 VPVTIPSGTVSASSGSPKSDNLGNEPPIVWVTLSGSPVTLTLSTPVKL 691 >gb|ESZ97904.1| hypothetical protein SBOR_1703 [Sclerotinia borealis F-4157] Length = 761 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/49 (53%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 3 IPVTFPGDASGS--GTKDKIGNEPLIMWVTLSGQPVTLTLSTPLAI*AS 143 IPVT PG + + T ++IGN+P+ +WVTLSG PV+ TLSTP+A+ +S Sbjct: 713 IPVTLPGPVTDTKGATTEQIGNDPITLWVTLSGAPVSFTLSTPIAVASS 761