BLASTX nr result
ID: Akebia25_contig00062132
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00062132 (245 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME79921.1| hypothetical protein MYCFIDRAFT_70836 [Pseudocerc... 64 3e-08 gb|EME39696.1| hypothetical protein DOTSEDRAFT_75371 [Dothistrom... 64 3e-08 gb|EMC91299.1| hypothetical protein BAUCODRAFT_28424 [Baudoinia ... 64 3e-08 ref|XP_007587300.1| putative 60s ribosomal protein l36 protein [... 62 6e-08 gb|EOA80963.1| hypothetical protein SETTUDRAFT_166386 [Setosphae... 62 6e-08 gb|EMD62087.1| hypothetical protein COCSADRAFT_227912 [Bipolaris... 62 6e-08 ref|XP_001939089.1| 60S ribosomal protein L36 [Pyrenophora triti... 62 6e-08 gb|EMF10130.1| 60S ribosomal protein L36 [Sphaerulina musiva SO2... 62 8e-08 gb|EWC46294.1| 60S ribosomal protein L36 [Drechslerella stenobro... 61 1e-07 dbj|GAD96388.1| abc transporter [Byssochlamys spectabilis No. 5] 60 3e-07 ref|XP_001794331.1| hypothetical protein SNOG_03785 [Phaeosphaer... 60 3e-07 ref|XP_003833584.1| similar to 60S ribosomal protein L36 [Leptos... 60 4e-07 ref|XP_007589793.1| ribosomal protein L36e [Colletotrichum fiori... 59 5e-07 gb|EQB52081.1| hypothetical protein CGLO_08318 [Colletotrichum g... 59 5e-07 gb|EPS43080.1| hypothetical protein H072_2940 [Dactylellina hapt... 59 5e-07 ref|XP_007278050.1| 60s ribosomal protein l36 [Colletotrichum gl... 59 5e-07 emb|CCF41582.1| 60S ribosomal protein L36 [Colletotrichum higgin... 59 5e-07 gb|EFQ29357.1| ribosomal protein L36e [Colletotrichum graminicol... 59 5e-07 ref|XP_002843418.1| 60S ribosomal protein L36 [Arthroderma otae ... 58 2e-06 gb|EXJ65401.1| 60S ribosomal protein L36 [Cladophialophora yegre... 57 2e-06 >gb|EME79921.1| hypothetical protein MYCFIDRAFT_70836 [Pseudocercospora fijiensis CIRAD86] Length = 106 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 3 LAKKRLGTFGRAKRKVDEMTKVIAESRRAGH 95 LAKKRLGTFGRAKRKVDEMTKVIAESRRAGH Sbjct: 76 LAKKRLGTFGRAKRKVDEMTKVIAESRRAGH 106 >gb|EME39696.1| hypothetical protein DOTSEDRAFT_75371 [Dothistroma septosporum NZE10] Length = 106 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 3 LAKKRLGTFGRAKRKVDEMTKVIAESRRAGH 95 LAKKRLGTFGRAKRKVDEMTKVIAESRRAGH Sbjct: 76 LAKKRLGTFGRAKRKVDEMTKVIAESRRAGH 106 >gb|EMC91299.1| hypothetical protein BAUCODRAFT_28424 [Baudoinia compniacensis UAMH 10762] Length = 106 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 3 LAKKRLGTFGRAKRKVDEMTKVIAESRRAGH 95 LAKKRLGTFGRAKRKVDEMTKVIAESRRAGH Sbjct: 76 LAKKRLGTFGRAKRKVDEMTKVIAESRRAGH 106 >ref|XP_007587300.1| putative 60s ribosomal protein l36 protein [Neofusicoccum parvum UCRNP2] gi|485918583|gb|EOD45224.1| putative 60s ribosomal protein l36 protein [Neofusicoccum parvum UCRNP2] Length = 106 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +3 Query: 3 LAKKRLGTFGRAKRKVDEMTKVIAESRRAGH 95 LAKKRLGTFGRAKRKVDEMTKVIAE+RRAGH Sbjct: 76 LAKKRLGTFGRAKRKVDEMTKVIAEARRAGH 106 >gb|EOA80963.1| hypothetical protein SETTUDRAFT_166386 [Setosphaeria turcica Et28A] Length = 106 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +3 Query: 3 LAKKRLGTFGRAKRKVDEMTKVIAESRRAGH 95 LAKKRLGTFGR+KRKVDEMTKVIAESRRAGH Sbjct: 76 LAKKRLGTFGRSKRKVDEMTKVIAESRRAGH 106 >gb|EMD62087.1| hypothetical protein COCSADRAFT_227912 [Bipolaris sorokiniana ND90Pr] gi|451998604|gb|EMD91068.1| hypothetical protein COCHEDRAFT_1176853 [Bipolaris maydis C5] gi|477588771|gb|ENI05849.1| hypothetical protein COCC4DRAFT_71532 [Bipolaris maydis ATCC 48331] gi|576924596|gb|EUC38705.1| hypothetical protein COCCADRAFT_82570 [Bipolaris zeicola 26-R-13] gi|576927489|gb|EUC41173.1| hypothetical protein COCMIDRAFT_106853 [Bipolaris oryzae ATCC 44560] gi|578494530|gb|EUN31916.1| hypothetical protein COCVIDRAFT_86382 [Bipolaris victoriae FI3] Length = 106 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +3 Query: 3 LAKKRLGTFGRAKRKVDEMTKVIAESRRAGH 95 LAKKRLGTFGR+KRKVDEMTKVIAESRRAGH Sbjct: 76 LAKKRLGTFGRSKRKVDEMTKVIAESRRAGH 106 >ref|XP_001939089.1| 60S ribosomal protein L36 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|330929480|ref|XP_003302655.1| 60S ribosomal protein L36 [Pyrenophora teres f. teres 0-1] gi|187975182|gb|EDU41808.1| 60S ribosomal protein L36 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|311321844|gb|EFQ89255.1| hypothetical protein PTT_14563 [Pyrenophora teres f. teres 0-1] Length = 106 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +3 Query: 3 LAKKRLGTFGRAKRKVDEMTKVIAESRRAGH 95 LAKKRLGTFGR+KRKVDEMTKVIAESRRAGH Sbjct: 76 LAKKRLGTFGRSKRKVDEMTKVIAESRRAGH 106 >gb|EMF10130.1| 60S ribosomal protein L36 [Sphaerulina musiva SO2202] Length = 106 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 3 LAKKRLGTFGRAKRKVDEMTKVIAESRRAGH 95 LAKKRLGTFGRAKRKVDEMTKVIAESRR GH Sbjct: 76 LAKKRLGTFGRAKRKVDEMTKVIAESRRVGH 106 >gb|EWC46294.1| 60S ribosomal protein L36 [Drechslerella stenobrocha 248] Length = 103 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +3 Query: 3 LAKKRLGTFGRAKRKVDEMTKVIAESRRAGH 95 LAKKRLGTFGRAKRKVDE+T+VIAESRRAGH Sbjct: 73 LAKKRLGTFGRAKRKVDELTRVIAESRRAGH 103 >dbj|GAD96388.1| abc transporter [Byssochlamys spectabilis No. 5] Length = 2174 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +3 Query: 3 LAKKRLGTFGRAKRKVDEMTKVIAESRRAGH 95 LAKKRLGTFGRAKRKVDEM KVIAE+RRAGH Sbjct: 2144 LAKKRLGTFGRAKRKVDEMQKVIAEARRAGH 2174 >ref|XP_001794331.1| hypothetical protein SNOG_03785 [Phaeosphaeria nodorum SN15] gi|111067870|gb|EAT88990.1| hypothetical protein SNOG_03785 [Phaeosphaeria nodorum SN15] Length = 106 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +3 Query: 3 LAKKRLGTFGRAKRKVDEMTKVIAESRRAGH 95 LAKKRLGTFGRAKRKV+EMT VIAESRRAGH Sbjct: 76 LAKKRLGTFGRAKRKVEEMTNVIAESRRAGH 106 >ref|XP_003833584.1| similar to 60S ribosomal protein L36 [Leptosphaeria maculans JN3] gi|312210132|emb|CBX90219.1| similar to 60S ribosomal protein L36 [Leptosphaeria maculans JN3] Length = 106 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +3 Query: 3 LAKKRLGTFGRAKRKVDEMTKVIAESRRAGH 95 LAKKRLGTFGRAKRKV+EMT VIAESRRAGH Sbjct: 76 LAKKRLGTFGRAKRKVEEMTTVIAESRRAGH 106 >ref|XP_007589793.1| ribosomal protein L36e [Colletotrichum fioriniae PJ7] gi|588907125|gb|EXF86536.1| ribosomal protein L36e [Colletotrichum fioriniae PJ7] Length = 106 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +3 Query: 3 LAKKRLGTFGRAKRKVDEMTKVIAESRRAGH 95 LAKKRLGTFGRAKRKV+EMT+VIAESRR GH Sbjct: 76 LAKKRLGTFGRAKRKVEEMTRVIAESRRVGH 106 >gb|EQB52081.1| hypothetical protein CGLO_08318 [Colletotrichum gloeosporioides Cg-14] Length = 106 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +3 Query: 3 LAKKRLGTFGRAKRKVDEMTKVIAESRRAGH 95 LAKKRLGTFGRAKRKV+EMT+VIAESRR GH Sbjct: 76 LAKKRLGTFGRAKRKVEEMTRVIAESRRVGH 106 >gb|EPS43080.1| hypothetical protein H072_2940 [Dactylellina haptotyla CBS 200.50] Length = 104 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +3 Query: 3 LAKKRLGTFGRAKRKVDEMTKVIAESRRAGH 95 LAKKRLGTFGRAKRKVDE+T VIAE+RRAGH Sbjct: 74 LAKKRLGTFGRAKRKVDELTNVIAEARRAGH 104 >ref|XP_007278050.1| 60s ribosomal protein l36 [Colletotrichum gloeosporioides Nara gc5] gi|429858054|gb|ELA32888.1| 60s ribosomal protein l36 [Colletotrichum gloeosporioides Nara gc5] Length = 106 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +3 Query: 3 LAKKRLGTFGRAKRKVDEMTKVIAESRRAGH 95 LAKKRLGTFGRAKRKV+EMT+VIAESRR GH Sbjct: 76 LAKKRLGTFGRAKRKVEEMTRVIAESRRVGH 106 >emb|CCF41582.1| 60S ribosomal protein L36 [Colletotrichum higginsianum] Length = 106 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +3 Query: 3 LAKKRLGTFGRAKRKVDEMTKVIAESRRAGH 95 LAKKRLGTFGRAKRKV+EMT+VIAESRR GH Sbjct: 76 LAKKRLGTFGRAKRKVEEMTRVIAESRRVGH 106 >gb|EFQ29357.1| ribosomal protein L36e [Colletotrichum graminicola M1.001] Length = 106 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +3 Query: 3 LAKKRLGTFGRAKRKVDEMTKVIAESRRAGH 95 LAKKRLGTFGRAKRKV+EMT+VIAESRR GH Sbjct: 76 LAKKRLGTFGRAKRKVEEMTRVIAESRRVGH 106 >ref|XP_002843418.1| 60S ribosomal protein L36 [Arthroderma otae CBS 113480] gi|238844720|gb|EEQ34382.1| 60S ribosomal protein L36 [Arthroderma otae CBS 113480] Length = 103 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +3 Query: 3 LAKKRLGTFGRAKRKVDEMTKVIAESRRAGH 95 LAKKRLGT GRAKRKVD+M KVIAESRRAGH Sbjct: 73 LAKKRLGTLGRAKRKVDDMQKVIAESRRAGH 103 >gb|EXJ65401.1| 60S ribosomal protein L36 [Cladophialophora yegresii CBS 114405] Length = 106 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +3 Query: 3 LAKKRLGTFGRAKRKVDEMTKVIAESRRAGH 95 LAKKRLGT+GRAKRKVDE+T+VIAE+RR GH Sbjct: 76 LAKKRLGTYGRAKRKVDELTRVIAEARRTGH 106