BLASTX nr result
ID: Akebia25_contig00062080
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia25_contig00062080 (316 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME88295.1| hypothetical protein MYCFIDRAFT_86068 [Pseudocerc... 63 5e-08 >gb|EME88295.1| hypothetical protein MYCFIDRAFT_86068 [Pseudocercospora fijiensis CIRAD86] Length = 360 Score = 62.8 bits (151), Expect = 5e-08 Identities = 38/77 (49%), Positives = 45/77 (58%) Frame = -3 Query: 314 QLYLQTTTLPDGTRSTITSFAVVGAGXXXXXXXXXXXXXXXXXXXPGLASGAAVASSPYA 135 +L ++TTTLPDG RSTITSFA VG GL SGA + SS +A Sbjct: 285 ELQVRTTTLPDGQRSTITSFAEVGGATDVPSAGSSPSASATGMP--GLQSGAGMPSSRFA 342 Query: 134 AEVALLFGVAIGVAGLV 84 AEVA+ G AIG+AGLV Sbjct: 343 AEVAIFVGAAIGLAGLV 359